KEGG   Alkaliphilus oremlandii: Clos_2526Help
Entry
Clos_2526         CDS       T00607                                 

Definition
(GenBank) helicase, RecD/TraA family
  KO
K03581  exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
aoe  Alkaliphilus oremlandii
Pathway
aoe03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:aoe00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Clos_2526
Enzymes [BR:aoe01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     Clos_2526
DNA repair and recombination proteins [BR:aoe03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     Clos_2526
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_30 HHH_4 AAA_19 UvrD_C_2 HHH_5 AAA_11 Viral_helicase1 PIF1 T2SSE HHH Helicase_RecD HHH_2 AAA PhoH AAA_24 UvrD-helicase RsgA_GTPase AAA_28 AAA_22 TrwB_AAD_bind AAA_14 UvrD_C Herpes_Helicase DUF2075 SRP54 DEAD AAA_18 MMR_HSR1 ATPase_2 AAA_5 FtsK_SpoIIIE AAA_16 AAA_29 ABC_tran PRK cobW CbiA AAA_10 Zeta_toxin NTPase_1
Motif
Other DBs
NCBI-ProteinID: ABW20057
UniProt: A8MJS5
Position
complement(2731601..2733847)
Genome map
AA seq 748 aa AA seqDB search
MKSLGGSIVVEIEGRLVEIIFQNEGNGYLVGILDCEEEEVTIVGCLPALKEGEVIAAKGN
WIVHPVYGRQLDVKEYRHVQPSTREGILNYLSSGVIKGIGKKMAERIIDHFGTDALEIIQ
YAPQRLTEVSGIGESKAETIAEAFEEQRELREIILFFSQYGITPSYAVRIYKKYKEMTIA
YIQENPYRLADEISGIGFKKADQIARAMGISLNSKYRIHSGIKYMLGTFHGEGHTYAPGD
ILIDRTRELLSVEESEVVEGIQELALKQKIQLERQDEEIIVYSMPYFYAETNTCNKLIEL
SQVELEPLEIDVDYEIESIEKEDGIALATNQKEAIRQSIENGIIVITGGPGTGKTTIINT
LIKVFGKLKKKILLAAPTGRASKRMTEATGKEAKTIHRLLEMGYSDDDDGMLFQRNEENP
LPADIIIIDEVSMVDIMLMNSLLKAISVGTRLIFVGDVDQLPSVGAGNVLRDIIDSKIIK
VVRLNEIFRQAEESMIVVNAHKINKGEYPILNHKDKDFYFMSRSRSEDILNTIIGLVKER
LPKHYKFDPIKDIQVLTPMKKGEVGSINLNKELQNYLNPPDKYKREKELREKVFRVGDKV
MQIKNNYTLKWASLDPDTEERQGEGVFNGDMGYIQHINPEAQELTVFFDDNRSVVYTYTQ
LDELELAYAITIHKSQGSEFPVVVMPVTWGPPMLLTRNLLYTAITRARSLVVLVGTENYL
NLMVSNNKIVERYSGLGIRLKKFYNFMT
NT seq 2247 nt NT seq  +upstreamnt  +downstreamnt
gtgaagtcgttgggaggaagcatcgtggtagaaatagaaggcagattggtagaaatcata
tttcagaacgaaggaaatggatatttagtaggcatattggattgtgaagaggaagaagtg
accattgtaggctgcttaccggctctaaaggaaggggaggtcattgcagcaaagggaaac
tggattgtccatcctgtctacggtagacagctggatgttaaagaatatcgtcatgtccag
ccttcaaccagagaagggatcttaaactatttatcctccggcgttattaaagggatcgga
aagaaaatggcggagcggatcatcgaccatttcggcacagatgctctagaaattatccag
tatgctcctcaaagactgacggaggtatcagggattggtgagtctaaggcagaaaccata
gcagaggcatttgaagaacaaagagagctccgagagattatcctttttttctcccaatac
ggaattaccccaagctatgcagttcgaatctataaaaaatacaaagagatgaccatagcc
tatatacaggaaaatccctaccgcttagccgatgaaatcagcggcattggctttaaaaaa
gcggatcaaattgcacgagctatgggaatctctctaaattcaaaatatcgaatccattct
ggaattaaatatatgctggggaccttccatggggaagggcacacttatgcgcctggcgac
atactcatagatcgaaccagggagcttttatctgtagaagaaagtgaagtggtggaaggt
atacaggagctggcattgaagcaaaaaatacagctagaaaggcaggatgaagaaatcatc
gtgtattccatgccatatttctatgcagaaaccaatacctgcaataagctgatagagctt
tctcaagtagaattagagccactggagatcgacgtggattatgaaatagaaagtatagaa
aaagaagacgggattgcccttgccacaaatcaaaaagaggccattcggcagtctatagaa
aacggtattattgtaatcacaggaggaccaggaactggtaaaacgacaattatcaatacc
ctaatcaaggtctttggaaagctgaaaaagaaaatattattggcagcaccaacaggaaga
gcttccaagcgtatgacggaggccactggaaaggaagcaaagactatccatcgattattg
gaaatgggctacagtgatgatgatgacggtatgctatttcaaagaaatgaagaaaatcca
ctaccagcagatatcatcatcatcgatgaggtgtccatggtggatattatgctgatgaac
agccttttaaaagctatatccgttggtacgagattgatatttgttggcgacgtggatcag
ctaccgtccgtcggtgcaggcaatgtactgcgggatattatcgatagtaaaattatcaag
gttgtacgcctcaatgaaatttttcggcaggcagaagaaagtatgattgtagtcaatgcc
cataaaataaacaaaggggagtatcccatattgaaccataaggacaaggacttctatttt
atgtccagaagtcggtcggaggatatcctcaatacgatcataggattggtgaaggaaaga
ctaccgaagcattataaattcgatccaatcaaagatattcaggtgttaacccccatgaaa
aaaggcgaggtaggcagtatcaatcttaacaaagagctacaaaattatttaaatccaccc
gataaatataagagagagaaagaactgcgcgagaaagtcttccgtgtgggggataaagta
atgcagattaaaaataactatacattaaaatgggcaagtctagatccggacacagaggag
cgacagggcgaaggtgtattcaatggagatatgggatatatacagcatattaacccagaa
gcccaagaactgacagttttcttcgatgataaccgcagtgtggtgtatacctatacccaa
ttagatgagctggagcttgcatacgccattaccatacacaaaagccagggaagtgaattc
ccagtggtggtgatgcctgtcacatggggaccgccaatgctcttaactcggaacctttta
tatacagcaataaccagagcaaggtccttagtcgttctcgtagggacagaaaactattta
aacctcatggtgagtaacaataagatcgtggagcgatattctggtcttggaataagatta
aaaaagttttataactttatgacctaa

DBGET integrated database retrieval system