KEGG   Alkaliphilus oremlandii: Clos_2662Help
Entry
Clos_2662         CDS       T00607                                 

Definition
(GenBank) methionyl-tRNA synthetase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
aoe  Alkaliphilus oremlandii
Pathway
aoe00450  Selenocompound metabolism
aoe00970  Aminoacyl-tRNA biosynthesis
aoe01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aoe00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    Clos_2662
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    Clos_2662
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:aoe01007]
    Clos_2662
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:aoe03016]
    Clos_2662
Enzymes [BR:aoe01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     Clos_2662
Amino acid related enzymes [BR:aoe01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   Clos_2662
Transfer RNA biogenesis [BR:aoe03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    Clos_2662
 Prokaryotic type
   Other AARSs
    Clos_2662
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA_bind tRNA-synt_1e Anticodon_1 tRNA-synt_1f DNA_pol3_a_NI RgpF NAD_binding_5 B12-binding ARL2_Bind_BART
Motif
Other DBs
NCBI-ProteinID: ABW20193
UniProt: A8MK61
Position
complement(2892576..2894540)
Genome map
AA seq 654 aa AA seqDB search
MSKGTFYLTTPIYYPSGRLHIGHTYTTVAADVLARFKRFTGYDVQFLTGTDEHGEKIQEA
AEKAGVSPKEYLDKIVEEIKDLWKKMDISYDIFIRTTDQEHEERVQKIFQTLYDKGDIYK
SEYEGWYCTPCESFWTETQLKEGHVCPDCNRPAHLAKEEAYFFKLSKYQDRLLQYFEEHP
EICYPESRKNEMVNNFLKPGLEDLCVSRTTFDWGIKVPFDPKHIIYVWFDAVCNYITALG
YGSDNEETFNKYWPADVHLVGKEIVRFHTIIWPAILMALEIPLPKMVYGHGWILFGADKM
SKSKGNIVYPEPLIERYGLDAIKYFLLREFTFGQDGNHTNRNFINRLNSDLANDLGNLVS
RTVSMIEKYNEGIIPSPGVEGEFDGSLKEIATGAASKVENAINKLQFHDGLEEIWKVVRK
TNKYIDETAPWVLAKDEANKERLNTVLYNLAEAIRIISVLIKPFMESTTNKIWSQVGITE
DQGTDWESTGTFGKLKAGTAVKKGEALFPRLELEKEMEALENINAAYLEKISGAQESKEE
EIVITAKEQITIDDFDKVELRAAKVLEAEKHPKADKLLVLQLQVGNEKRQVVSGIAAHYK
PEDLVGKTVILVANLKPVKLRGIESHGMILAASTDEKLVLGTVDSDIPSGASIS
NT seq 1965 nt NT seq  +upstreamnt  +downstreamnt
atgagcaagggaacattttatttaacgacacccatatattacccaagtggcagactgcat
atcggccatacttatacaaccgtagcagcggatgtactggctagattcaaaagattcaca
gggtacgacgtacaatttctaacaggcaccgacgaacatggagaaaagatacaggaggca
gcagaaaaagcaggagtttcaccgaaggagtatctagataaaatcgtagaagagataaag
gatctgtggaagaagatggacatctcctatgatattttcatccgaacaacggatcaggag
catgaagaaagagtacagaagattttccaaaccctatacgataaaggggatatttacaaa
agtgagtacgagggctggtattgtacaccttgcgaatccttctggacagagacacagtta
aaggaaggacacgtatgcccagactgtaatcgtccagctcatttagcaaaggaagaggct
tatttctttaaattatcaaaatatcaagatcgattgcttcaatactttgaagaacatccg
gaaatatgctatccagaatctagaaagaacgaaatggtcaacaatttcttaaaaccagga
ttagaggatctttgcgtatcccgaacaaccttcgattggggaattaaagtgccatttgat
ccaaagcatatcatatacgtatggttcgatgcagtatgtaactatattacagcattaggc
tatggctcagacaatgaagaaacctttaacaagtattggccagcagacgtccacttggta
ggaaaggaaattgttcgattccataccattatttggccagccatccttatggcattagaa
attccactacctaaaatggtttatggccatggatggattctttttggcgccgataaaatg
tcgaaatctaagggaaatattgtttatccagagccattaattgaacgctatggtttagat
gcgattaaatacttccttttaagagaatttacctttggacaagatggaaatcataccaat
cgaaacttcatcaatcgattgaactcagatcttgcaaatgatttaggaaatcttgtcagc
agaactgtatccatgattgaaaaatataatgaaggcattattccatcccctggagtagaa
ggagaattcgatggttctctaaaggaaattgccacaggtgcagcgagcaaggtagaaaat
gcaatcaataagctacagttccacgacggcttagaggaaatttggaaggttgtccgcaaa
acaaataaatatatagatgaaaccgctccttgggttcttgcaaaagatgaggcgaataaa
gaacgattaaatactgtattatataatttagcagaagccattcgaattatctctgttcta
ataaaaccatttatggaatctacgacaaataaaatttggagccaagtgggcataacagag
gatcaaggaaccgattgggaaagtacagggacctttgggaagttaaaggcaggcactgct
gtaaaaaaaggagaagccttattcccaagattagaattagaaaaggaaatggaggcccta
gaaaatatcaatgcagcttatctggagaaaatcagtggcgctcaggaatcaaaggaagaa
gagattgtgatcaccgctaaggagcaaatcaccatcgatgattttgataaagtagaactt
agggcagcaaaggttttagaggcagaaaaacatccaaaagcagataagctgctggttctg
caactacaggtaggcaatgaaaaaagacaggtcgtatcagggatcgcagcccactataag
ccagaggacttggttggtaagacagtgatattagtggcgaacttaaagccagtaaagttg
agaggcatcgaatcccacggtatgatattggctgcttctacagatgaaaaactggtattg
ggaaccgtggacagcgacataccgagtggtgcttccattagctaa

DBGET integrated database retrieval system