KEGG   Alkaliphilus oremlandii: Clos_2733
Entry
Clos_2733         CDS       T00607                                 
Name
(GenBank) kynureninase
  KO
K01556  kynureninase [EC:3.7.1.3]
Organism
aoe  Alkaliphilus oremlandii
Pathway
aoe00380  Tryptophan metabolism
aoe01100  Metabolic pathways
aoe01240  Biosynthesis of cofactors
Brite
KEGG Orthology (KO) [BR:aoe00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00380 Tryptophan metabolism
    Clos_2733
Enzymes [BR:aoe01000]
 3. Hydrolases
  3.7  Acting on carbon-carbon bonds
   3.7.1  In ketonic substances
    3.7.1.3  kynureninase
     Clos_2733
SSDB
Motif
Pfam: Aminotran_5 DegT_DnrJ_EryC1 Astro_capsid_p2
Other DBs
NCBI-ProteinID: ABW20264
UniProt: A8MKD2
Position
2976038..2977321
AA seq 427 aa
MIYEFKDGLEFAKELDRLDVLNSTRQRFYLNEGEIYMDGNSLGLSSKDAEAALQNVMNVW
RKEAIKIWGVEDGRYFKFSRNLAEKLKSLINADAEEIIVMGSITSNLHQALATFYTPTEA
RYKILVDALNFPSDIYATKSMIELKGYEVEDVLVQVQSKDGRTLCEEDIIAEMKEDVALI
LLPSVLYRSAQLLDMELITKEAHKRGIIIGWDLAHSIGSVPHDFKKIDPDFAVWCSYKYL
NGGPGANAGMYINRRHFGRNAGLKGWFGSKEESQFLMSHEFDQNNDANGFLLGTHNMFSM
APLDGSLNIFNEVGIETIRAKSLHITAYLMYLIDQKLSHHGYFIGNPREDSRRGGHVALE
HDEAYRISLALRDHKVIPDYREPNVIRLAPVALYVSYEEVYRLVEILEKIVTHKEYEHYS
LKRVTVL
NT seq 1284 nt   +upstreamnt  +downstreamnt
atgatttatgaatttaaagatggattggaatttgctaaggaattagatcgactggacgta
ctgaattctactcgccagcgcttctatttaaatgaaggcgaaatttacatggacggaaat
tccttgggtctcagctccaaggatgcagaagcggcacttcagaatgtaatgaatgtatgg
cgcaaggaagccattaagatttggggcgttgaggatgggcgttattttaagttctctaga
aaccttgcagaaaaattaaagtctttaattaatgcagatgctgaagagattattgtgatg
ggcagtattacctcaaaccttcaccaagcactggcaaccttttatacaccaacagaagcg
cgatacaagatcctcgttgatgcgttaaactttccctccgacatttatgctacgaaaagt
atgattgagctgaagggatatgaagttgaagacgtattggttcaggttcaaagcaaggat
ggacgcaccctctgtgaagaagatattatcgcagaaatgaaagaggatgttgccttgatt
ctgcttccatcggttctatatcgcagtgcccagcttctcgatatggagctgattacaaag
gaagcccataaacgaggcattatcatcggctgggacctagctcattccatcggctccgtt
cctcatgattttaaaaaaattgaccccgactttgcagtatggtgctcctataaatacctc
aacggtggcccaggggcaaatgctggtatgtatatcaatagaaggcatttcggtagaaat
gctggcctcaaaggatggtttggcagcaaggaagaaagtcaattccttatgagccatgag
ttcgatcaaaataacgatgccaacggctttctattgggaacgcacaatatgttttccatg
gcgccactggatggctctttgaatatctttaatgaagtaggtatagaaactatacgtgct
aaatccttgcacattaccgcttacttgatgtatttaatcgatcaaaaattatctcatcat
ggatatttcattgggaatcctcgtgaagatagccgtcgaggaggtcatgtggcactggaa
cacgatgaagcctaccgtattagcttagcgctacgggatcataaggtgattcccgactac
cgagagcccaatgtgattcgtcttgcgcccgtagccctgtacgtttcctatgaagaggtg
taccgcttagttgaaattcttgagaagattgttactcataaggaatatgaacactattcc
ttgaaaagagttactgtactgtag

DBGET integrated database retrieval system