KEGG   Asparagus officinalis (garden asparagus): 109820488Help
Entry
109820488         CDS       T05243                                 

Definition
(RefSeq) calcium-dependent protein kinase 19
  KO
K04515  calcium/calmodulin-dependent protein kinase (CaM kinase) II [EC:2.7.11.17]
Organism
aof  Asparagus officinalis (garden asparagus)
Brite
KEGG Orthology (KO) [BR:aof00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:aof01001]
    109820488
Enzymes [BR:aof01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.17  Ca2+/calmodulin-dependent protein kinase
     109820488
Protein kinases [BR:aof01001]
 Serine/threonine kinases: CAMK group
  CAMK2 family
   109820488
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr APH Kdo YrbL-PhoP_reg RIO1 Pkinase_fungal Kinase-like
Motif
Other DBs
NCBI-GeneID: 109820488
NCBI-ProteinID: XP_020242223
Position
8
AA seq 482 aa AA seqDB search
MGLVQLSPNSHCNCYKVPGLADPIIETPNFSYLQDKYVLGDQLGWGQFGVIRSCLDLVTG
ERLACKSIAKDRLVSAEDLRGVKLEIEVMAKLSGHPNVVELKAVYEEEGFVHLVMELCAG
GELFHWIEKFGRFSEADARRIFRDLMEVVVYCHENGIVHRDLKPENVLLATRERSSVIKV
ADFGLATYVEPGKSLYGTVGSPFYIAPEVLAGGYNEAADVWSAGVILYVLLSGMPPFWGK
TKSRIFESVRSAELQFPSDLWDSVTESAKELISGMLCRDPAKRFTAKQALDHSWIKDFAH
QAQSSNEHRSITNFGQKQNSGSCSFSTLHVSTSRDVSFGFSSPISCHSQTDPSSPRFTCQ
SSFSTYCDNVPPTIGFSFQNNCESNVQLMPNFSFFSPPPSDDQEIAQRDSSIVELCVSIN
SANDKEPERKGVEFTTISIRSKRNHTIGLGEQLDIMVSETVIRWASCTGLPSAPSLRASL
VC
NT seq 1449 nt NT seq  +upstreamnt  +downstreamnt
atgggtctggttcaattgtccccaaactcccactgcaactgctacaaagtccctgggctt
gcggatccaatcatagaaacccccaatttctcttatttacaagataagtacgttctcggg
gatcaattgggctggggtcaatttggggtgatccgttcttgcttggatttggtcaccgga
gagaggttagcttgtaaatcgatcgcaaaggatcggttggtctcggctgaggacttgagg
ggtgtgaagctggagatcgaggtgatggcgaagctctcggggcacccgaatgtggtggag
ttgaaggctgtgtatgaggaggaagggtttgtgcatttggttatggagctttgtgctgga
ggggagttgtttcattggattgagaagtttgggaggttctcggaggccgatgcgaggaga
attttcagggatttgatggaggttgtggtgtattgtcacgagaatgggattgtgcatcga
gatcttaagccggagaatgttttgttggcgacgagggagaggtcgtcggtgatcaaggtt
gcggattttgggttggctacttatgttgagccagggaagagcttatatggtactgtgggc
agtcctttctacatagcaccagaagtattagctggtggatacaatgaagcggcggatgtg
tggagtgctggagttattctatacgttcttctaagtggaatgcctccattttgggggaaa
acaaagtcaaggatctttgaatctgtgaggtctgctgagcttcagttcccttctgacctt
tgggatagcgtaacagaatctgcaaaggaattgatctctggcatgctgtgtagggatcct
gcaaagagatttactgccaagcaggctttagatcattcgtggataaaggactttgctcat
caagcacaaagctccaacgagcatcgcagtataacaaattttggacaaaaacagaactca
ggatcgtgttccttttcaacccttcatgtatccacatcccgtgatgttagcttcggtttt
tcttcacccatttcttgtcatagtcagaccgatccttcttcccctagattcacttgtcaa
tcatcattttctacttattgtgataatgtccctcccacaattggcttctccttccagaac
aattgtgagtctaatgtccaattgatgcctaatttctcatttttcagtccccctccttca
gatgatcaagaaattgcccagagagattcaagcattgttgaattgtgcgtgtccataaat
tccgcaaatgacaaggaaccagaacgcaagggggttgaattcaccacgattagtatccga
agcaagagaaatcacacaattggtctcggtgagcagcttgatatcatggtatcagagaca
gtgatacggtgggcttcatgcacgggcctcccaagtgcaccatcacttcgagcctccctc
gtttgctga

DBGET integrated database retrieval system