KEGG   Asparagus officinalis (garden asparagus): 109821164Help
Entry
109821164         CDS       T05243                                 

Definition
(RefSeq) serine/threonine receptor-like kinase NFP
Organism
aof  Asparagus officinalis (garden asparagus)
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase
Motif
Other DBs
NCBI-GeneID: 109821164
NCBI-ProteinID: XP_020242942
Position
8
AA seq 583 aa AA seqDB search
MGLSFFLIEIVLPTLLLNLTASIISAQSTDKNITDFSCSASPCKTYVTYRTQPPDYIELG
QVSDLFGVSRLSIMTANNLPSEDVTFFPDQLVFVPILCGCTGNRSFVNTTYEIKAGDSFY
FVSISAFENLTDYQVVQDSNPMLVPASLKVGQEVIFPIYCQCPSKTQLDQGFKFLVTYVW
QREDDISSLSRKMNTSSEAIVIANNYRNFSDAIAFPILIPVSRLPLLPSRYYNTSSREKQ
NANGLGSVWLVSLLVTSSIETAGLLQLKSTSSTDQNFSPRVADKLLTGLTEYIDKPVIFE
TQTILDATRNLDQKFRISTSIYKAILCGGEVFAVKQMQGDGSQEVNILRKVNHANLVKLI
GISTGINGKCFLVYEFVENESLDKWLYPENASSSRSVYFLSWKQRLMIALDVANGLQYLH
EHTTPNIVHRDIRTRSILLDSNFKAKISNFSNAQAASNSISPMIDIFGFGIVLLELLSGR
RAVGTKELLKEIRLVFYAEEKVEERLRKFMDSSLGEFYPIEGALSLASVARACTSELSLQ
RPRMCDIALSLSLLAHSSSGELETRLSSHSGETVGINNPIIAR
NT seq 1752 nt NT seq  +upstreamnt  +downstreamnt
atggggctatccttcttcctcattgaaattgttctcccaacccttcttctcaacttgaca
gcctccattatctctgctcaatcaaccgataaaaatatcactgatttctcatgctcggct
tcaccctgtaaaacttacgtcacataccggactcagccccctgactatattgaactcggt
caggtttctgatctctttggtgtcagccgtctctctataatgacagcaaataatctacca
tcggaggatgtcacttttttccctgaccaacttgtttttgtcccgattttatgtggctgc
accggaaaccgatcctttgtcaacaccacgtatgagatcaaggctggagacagcttttac
ttcgtttcaatcagtgcgtttgagaatcttacggattatcaggtcgtccaagattcaaat
ccgatgctggttcccgccagtctgaaggttgggcaggaagtcattttccctatttactgc
cagtgcccctccaagacccaattggatcagggattcaaattccttgtaacttacgtttgg
caacgagaagacgacatctcttcactgagtaggaaaatgaatacatcatctgaagccata
gtcattgctaacaactatagaaatttcagtgatgcaattgcttttcctatactgattcca
gtctcaaggctcccactacttccatcacgctactacaacacctcctctcgtgagaagcag
aatgccaatggcctcggaagtgtctggctcgtatcacttctagtcacttctagtattgaa
accgccggtctccttcaattaaagagtacctcatctactgatcaaaatttcagtcctagg
gtagcagacaagctattgaccggattaacagagtacatagacaagccagtcatctttgag
acccaaacgatcttagacgccacgaggaatttagatcagaaatttagaatcagtacttca
atttataaagccatcctctgtggaggagaagtgtttgctgtgaagcaaatgcaaggtgat
ggctcacaggaggtaaatatactacgaaaggtcaatcatgcaaacttagtgaagttgatt
gggatttctacaggaattaatgggaaatgcttcttggtttatgaatttgtagagaatgag
tctttggataaatggttgtacccagaaaatgcatcctcttcgagatctgtgtactttctt
tcatggaagcagaggctgatgatagctttggatgttgctaatggccttcagtatttgcac
gagcatactacgccaaacattgttcacagagatattcgtacaagaagcatccttctcgat
tctaatttcaaggctaagatatcaaacttctctaatgcccaagctgcatcaaattctata
tccccaatgattgatatctttggtttcgggattgtcctattagagttgctctcaggcagg
agggctgtaggaaccaaagaattgttgaaggagataaggttggttttttatgctgaggag
aaggttgaggagagactaaggaaatttatggattctagtcttggcgagttttatcctata
gagggagctttaagcctggcatcggtggcgagggcttgcacttcagagctttcattgcag
aggccaaggatgtgtgatatagcgttaagcctctcgcttcttgctcactcgagcagtggt
gagcttgaaacgaggttgagttctcattctggggagactgttgggattaataatcccatt
atcgcccgttga

DBGET integrated database retrieval system