KEGG   Asparagus officinalis (garden asparagus): 109821165Help
Entry
109821165         CDS       T05243                                 

Definition
(RefSeq) protein LYK5-like
  KO
K04733  interleukin-1 receptor-associated kinase 4 [EC:2.7.11.1]
Organism
aof  Asparagus officinalis (garden asparagus)
Brite
KEGG Orthology (KO) [BR:aof00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:aof01001]
    109821165
Enzymes [BR:aof01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     109821165
Protein kinases [BR:aof01001]
 Serine/threonine kinases: TKL group
  IRAK family
   109821165
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase Rax2 LysM DUF347 SKG6
Motif
Other DBs
NCBI-GeneID: 109821165
NCBI-ProteinID: XP_020242943
Position
8
AA seq 475 aa AA seqDB search
MLSALIGENPYKPEKLFGGLDLLVPLRCACPTKNQTQDGTKYLMTYSLNENDNLSDLSER
FNVSDDKVGNANGFVDPDPVVYPSTTVLIPLPRKPLSSQTQIYHPLEYSPPPRSCPIIRK
AKRLTTGLHVGIGAAISVAVLFLIVTVLLWLRRKKMKRMVMKNNNVVSKDIANAVSIIDC
PLKIFLVEEIKEATKYFSSECRIQGSVYKGIIGENVSAIKKISKDMSQEVNILHKLNHVN
IISLHGICTGEENCYLVYEFMENGSLKDWLKNPNRSGLLKWTQKVQIALDIANGLDYIHN
FTYPPYIHKDITSSNVLLNGKLRAKITNFTLARSSDCRKSGSYLTKNVEGTLGYMAPEFI
ESGLITPKLDVYAFGVVISELITGKKAINVSKGREELLSESIVSIVEGNNADRELMGFME
STMRSISPVGLVTEVAKLCVACLARDPERRPSMHQVVSVLTRVQVDSQMWALAYQ
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
atgctcagcgctctcataggcgagaacccttataaacctgagaaactatttggcggtctt
gatttgttagttcctcttcgatgtgcatgccctacaaagaatcagactcaggatggtaca
aagtatctgatgacatactctctcaatgagaatgacaatctttctgatcttagcgaaaga
tttaatgtcagtgatgacaaagttgggaatgctaacgggtttgttgatccagacccggtt
gtttatccatccaccacagtgctcatcccattgccaagaaaacccttgagctcgcaaact
caaatttatcacccacttgagtacagtccacctccccgttcatgtccaatcattcgtaag
gctaaaagattaactacaggacttcatgtaggtattggtgcagctatttctgttgcagtt
ctgtttcttatcgttacagttttattgtggcttcgaagaaagaagatgaaaagaatggtg
atgaagaataacaatgttgtatcaaaagatattgctaacgccgtgtcaataatagactgc
ccattgaagatatttctggttgaggaaataaaagaggcgactaaatatttcagctcagag
tgcaggatacaaggatcagtgtataagggaataatcggcgaaaatgtgtctgcaatcaag
aagataagtaaggatatgtcacaggaagttaacatactgcacaaactcaatcatgtcaat
attataagcctccatggaatttgtacaggagaagaaaactgctatttagtctatgaattc
atggagaacgggtctctgaaggattggctcaagaatcctaatcgatctgggctcttgaag
tggacccaaaaggttcagattgctctggacatcgctaatgggctcgattacatacacaac
ttcacatatccgccatatattcacaaggatataacgagcagtaatgttctccttaacggg
aaattgagagctaaaataacaaactttacactggcaagatcatcagactgtagaaagtcc
ggttcctacttaacaaagaatgttgagggtactctcggttatatggcacctgagttcata
gaatctggactcataacgccgaaacttgatgtatatgcatttggggtagttatatcggaa
cttattacaggaaagaaagctataaatgtaagcaaagggagagaagaactgttatcggaa
tcgatagtttccattgtagaaggaaacaatgcagatcgagagcttatgggcttcatggag
tctactatgagaagcataagccctgtaggtttagtaacggaggtagcaaaactatgtgtg
gcttgtttggcaagagatccagagaggagacctagcatgcatcaggttgtctcagttttg
acaagggttcaagtagattcacagatgtgggctttggcataccaatag

DBGET integrated database retrieval system