KEGG   Asparagus officinalis (garden asparagus): 109822208Help
Entry
109822208         CDS       T05243                                 

Definition
(RefSeq) PTI1-like tyrosine-protein kinase At3g15890
Organism
aof  Asparagus officinalis (garden asparagus)
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr APH ABC1 PIP49_C
Motif
Other DBs
NCBI-GeneID: 109822208
NCBI-ProteinID: XP_020243966
Position
8
AA seq 365 aa AA seqDB search
MLKCFCCVLRNPEDSDRVITSSNKRYSYPWQIYSLKELLAATNNFHDDNKIGEGGFGTVY
YGKTSKGEEIAVKRLKAMTAKAEMEFTVEVEVLGRVRHQNLLGLRGFYAGGDERLIVYDY
MPNLSLVNHLHAKHPARVPLDWPRRMDIAVGSAQGLAYLHHQTTPHIIHRDIKASNVLLD
SDFRPKVADFGFAKLIPDGVSHLTTKVKGTLGYLAPEYAMWGKVSESCDVYSFGILLLEM
ISGRKPIEKLPGGIKRDITQWVTPWVESRMWDKIVDPRLGDNYDRLQAKNVVMVAVRCTD
GNPDIRPTMNEVVEFLNSGTLMGETTSTKELIRLMTLHKDISEEADDAPEISVTASKLYV
REMRR
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atgcttaaatgcttctgttgcgtcctccgcaatcctgaagattcagacagggttattact
agcagcaacaagaggtattcatatccatggcagatatacagcctgaaagagcttctggct
gccaccaacaacttccacgatgataacaagatcggcgagggaggctttggcacagtctac
tacggcaaaacaagcaaaggagaagagatagccgtgaagagactgaaggcgatgacggca
aaggcggagatggagttcaccgtggaagtggaggtgctcggaagggtgaggcaccagaat
ctcctcggacttcggggattctatgcaggtggagatgagaggctgatagtgtatgactac
atgcccaatctcagcctagtcaaccatctccacgccaagcaccctgcccgtgtccctctc
gattggcctcgtcgcatggacatcgccgttggatcagcccaaggactggcttatctgcat
caccagacgactccgcacattatacatcgggatatcaaggcaagcaacgtacttcttgac
tctgacttcaggccaaaggtggctgactttggatttgcaaagctgattcccgatggagtg
agccacctcaccacaaaagtgaagggcacgctgggctacctcgcaccagaatatgccatg
tggggcaaggtgtcagagagctgcgacgtgtacagcttcgggatcctgctgcttgagatg
ataagcggaaggaagccgatagagaagctaccgggcgggataaagagggacataacgcag
tgggtgacgccgtgggtggagagtagaatgtgggataagattgtggatcccaggttggga
gacaattacgaccggttgcaggccaagaatgtggtcatggtggctgtgaggtgcactgat
ggaaatccagatattaggcccaccatgaatgaggttgtggagttcttaaacagcggaaca
ttaatgggggagacgacgagcaccaaagaactgatcagattaatgacgctgcacaaagat
atatccgaggaggctgatgatgcccctgaaattagcgtcacagcttctaagttatacgtg
agggaaatgaggagatag

DBGET integrated database retrieval system