KEGG   Asparagus officinalis (garden asparagus): 109823677Help
Entry
109823677         CDS       T05243                                 

Definition
(RefSeq) beta-fructofuranosidase, insoluble isoenzyme 3-like
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
aof  Asparagus officinalis (garden asparagus)
Pathway
aof00052  Galactose metabolism
aof00500  Starch and sucrose metabolism
aof01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aof00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    109823677
   00500 Starch and sucrose metabolism
    109823677
Enzymes [BR:aof01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     109823677
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C
Motif
Other DBs
NCBI-GeneID: 109823677
NCBI-ProteinID: XP_020245594
Position
9
AA seq 575 aa AA seqDB search
MAIFNRVTWLLVFLLCCWRNGMVDGTHVVYHELMSTSVPSIVVDNQYRTGYHFQPPKNWI
NDPNGPMYYNGVYHLFYQYNPKGAVWGNIVWAHSVSKDLINWIPLEPAIYPSKPFDINGC
WSGSATILPGNKPAILYTGIDPQNRQVQNVAYPKNLSDPYLREWVKPDYNPIIEPTNGLN
ASSFRDPTTAWYGLDGRWRIVIGSKRKHRGMAILYRSKDFVHWVRAKHPLHSANGTGMWE
CPDFYPVAMGGELGVDTSEYGSGLKYVLKNSLDITRYEYYTLGTYNRNVDKYIPDGASAD
NRSGLRYDYGNFYASKTFYDQGKKRRILWGWSNESDSTRDDVSKGWAGIQTIPRKVWLDS
NGRQLLQWPVEELESIRGKQVYMMNKKVKGGDFVEVSGIMTAQSDVEVTFELSSLAKAEP
FDPTWTDPQKLCAQKGADVKGGVGPFGLLTLASARREEQTAVFFRIFKASDNYVTLMCHD
PSRSSVRPGLYKPTYGGWVDVEIKKKGKISLRSLIDHSVVESFGAEGKTCMTSRVYPSIA
VGDAAHLFVFNNGAEDVKITEMKAWEMKKPLMNGD
NT seq 1728 nt NT seq  +upstreamnt  +downstreamnt
atggcgattttcaatcgagttacatggttgttagtgttcttgttgtgctgctggaggaac
ggaatggtcgacggaactcatgttgtgtatcatgaactcatgtcgacgtcggtcccctcc
atcgtcgtcgataaccaatacaggaccggctatcacttccaaccaccaaagaactggatc
aatgatcctaatggtccgatgtattacaacggagtctaccacttattttatcagtacaac
cccaaaggcgcggtatggggcaacatagtatgggctcactcagtctcaaaggacttgatc
aattggatcccactcgaacctgcaatctacccatccaaaccgttcgacattaatgggtgc
tggtccggatccgctactatcttaccgggtaacaaacccgctatcctctacacgggcatc
gacccccaaaaccgtcaagtccaaaacgttgcgtacccgaagaacttgtcagatccttat
ctccgagaatgggtcaaacccgattacaacccgataatagagccgactaacgggctcaat
gctagctcgttcagagacccgacaacggcgtggtacggccttgatgggcgctggaggata
gtaattgggagcaaaaggaaacacagaggcatggctattttgtatagaagtaaggatttt
gtacattgggtccgcgcgaagcacccgttacactccgctaacggaacgggcatgtgggag
tgtccggatttctacccggtagcgatggggggagaattaggagtagatacgtcagaatac
ggtagtggactaaaatacgtgctgaaaaatagtttggatattacgcgatacgagtattat
acgcttggaacgtataatcgtaatgtagataaatacataccagatggcgcatcggcagat
aacaggtcgggtttaaggtatgattacggtaatttttacgcgtcgaagacgttttacgat
caagggaaaaagaggaggattttgtggggttggtctaacgagtccgatagtacacgagac
gatgtaagcaagggttgggctgggatccagactatacctagaaaagtttggcttgacagc
aacggccggcaactccttcagtggccggtggaggagctcgagtcaataagagggaagcaa
gtttacatgatgaacaagaaagttaagggcggagactttgtcgaagtttcaggaataatg
accgcgcagagtgacgtggaggtgacgttcgaattgtcaagccttgcgaaggctgagcca
tttgatcccacgtggaccgatcctcagaagctatgtgcacaaaagggtgcggatgtaaag
ggtggggtcggaccttttgggctgttgactttggcctcagccagaagagaggagcaaact
gctgttttctttcgaattttcaaagcttcagacaactacgtgactctcatgtgccatgac
ccatcaaggtcatcagtaaggcctggactatacaaaccaacttatggaggatgggttgat
gtagagatcaagaaaaaggggaagatttctctaaggagcctgattgatcactctgtggtg
gagagttttggtgctgaaggcaaaacttgcatgacatcaagagtttatccgagcatcgca
gtaggggacgcagcacatttgttcgtgttcaataatggagcagaagatgtgaagatcaca
gagatgaaggcatgggaaatgaagaagcctttgatgaatggggactaa

DBGET integrated database retrieval system