KEGG   Asparagus officinalis (garden asparagus): 109824229Help
Entry
109824229         CDS       T05243                                 

Definition
(RefSeq) phosphatidylserine decarboxylase proenzyme 2-like
  KO
K01613  phosphatidylserine decarboxylase [EC:4.1.1.65]
Organism
aof  Asparagus officinalis (garden asparagus)
Pathway
aof00564  Glycerophospholipid metabolism
aof01100  Metabolic pathways
aof01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:aof00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    109824229
Enzymes [BR:aof01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.65  phosphatidylserine decarboxylase
     109824229
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PS_Dcarbxylase Plant_vir_prot
Motif
Other DBs
NCBI-GeneID: 109824229
NCBI-ProteinID: XP_020246354
Position
9
AA seq 98 aa AA seqDB search
MQVAFVAIGATMVGSITFTREKGDYIHKGDEFGYFSFGGSTVICVFEKDAIQIDEDLISN
SERSLETLVYVGMRLGVVSKRAQAVKDISRLEQCKLEE
NT seq 297 nt NT seq  +upstreamnt  +downstreamnt
atgcaggtagcatttgttgcaataggagcaacaatggtaggaagcatcacgttcactaga
gaaaagggtgactacatccataaaggagacgagtttggatatttctcgtttggggggagc
actgttatatgcgtatttgaaaaggatgcaattcaaatagacgaggatcttatttcaaac
agtgaaagatccctcgaaacgctagtttatgtaggtatgagattgggtgtagtttcgaag
agggcacaggccgtgaaagatatatcaagattggagcagtgcaagctggaagaatga

DBGET integrated database retrieval system