KEGG   Asparagus officinalis (garden asparagus): 109825728Help
Entry
109825728         CDS       T05243                                 

Definition
(RefSeq) non-specific phospholipase C6-like
  KO
K01114  phospholipase C [EC:3.1.4.3]
Organism
aof  Asparagus officinalis (garden asparagus)
Pathway
aof00562  Inositol phosphate metabolism
aof00564  Glycerophospholipid metabolism
aof00565  Ether lipid metabolism
aof01100  Metabolic pathways
aof01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:aof00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    109825728
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    109825728
   00565 Ether lipid metabolism
    109825728
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02042 Bacterial toxins [BR:aof02042]
    109825728
Enzymes [BR:aof01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.3  phospholipase C
     109825728
Bacterial toxins [BR:aof02042]
 Type II toxins: Membrane damaging toxins
  Toxins that enzymatically damage the membrane
   109825728
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Phosphoesterase
Motif
Other DBs
NCBI-GeneID: 109825728
NCBI-ProteinID: XP_020248194
Position
10
AA seq 514 aa AA seqDB search
MQISKLITFLPLLPFLLHSPHLSNANQPIQAIVVLVLENRSFDHMLGWLDKDSSSSPTVD
GLTGEECNPRSTEEGLGSSVVCVSDDAQYVDPDPGHSFEAVKEQVFGTSTNSNIPTMSGF
VEQALTISDDLSTAVMKGFNPKSIPVFTKLSQEFATFDRWFSSLPGPTQPNRLFVYSATS
HGATSHNKWHLAKGYPQKTIFDSLHEDGLDFNVYFENAPTTLFYRNMRKLKYVRKFHKYG
TFLDHARDGRLASLSVIEPRYFDMKGKPANDDHPSHDIANGQKLVKEVYEALRSSPQWNE
SLLVITYDEHGGFYDHVVTPYTGIPNPDGILGQDNFGFDRLGVRVPTIVVSPWIKRGTVV
NKPKGPAENSEFEHSSIPATIKKMFNLTSGFLTQRDAWAGTFEGVVTELTSPRTDCPLVL
PDVPPLRTTQADEDRYVSEFQSEIVELASTLNGDHSLNIESLETKRRMKVKEADGYVDRA
ISSFFKACEEAISMGLEESTIVNLEASDTTTGAP
NT seq 1545 nt NT seq  +upstreamnt  +downstreamnt
atgcaaatatccaaactcatcaccttcctccccctcctccccttcctccttcactctcca
cacttgtccaatgccaaccaacccatccaagccatcgtagtcctcgtcctcgagaatcga
tctttcgatcacatgctcgggtggctcgacaaggatagctcttcttctcctacagttgac
ggactcaccggcgaagaatgcaatcctcggtcgactgaggagggcctcgggtcctctgta
gtttgcgtctctgatgatgctcagtatgtcgaccctgaccccggccattcttttgaggcc
gtcaaagaacaagttttcggtacctccaccaacagcaatatcccaaccatgtccggcttc
gttgaacaagccctcacaatctccgacgatctctccaccgccgtcatgaagggcttcaac
cctaaatccatcccagtgttcaccaaactctcccaagaattcgcgactttcgacaggtgg
ttctcctccctcccgggccccacgcagcccaaccgcctctttgtctactccgccacctcc
cacggtgccacgagccacaacaagtggcatctcgccaaagggtatccccagaagacgata
ttcgattcattacatgaagatgggctggatttcaacgtgtactttgagaatgcgccaacg
acgttgttctatcggaatatgaggaagttgaagtatgtgaggaagttccacaagtatggg
acgttcttggatcatgctagagatggcaggcttgctagcttgagtgtgatcgaacctagg
tattttgatatgaagggaaaaccagcaaatgatgatcacccatcgcatgatatcgccaac
gggcagaaattagtgaaggaagtgtatgaagccttgagatctagcccccaatggaatgag
agccttcttgttattacgtatgatgagcatggaggattttatgatcatgttgtgactcca
tacactggaattccgaacccagacgggattctgggccaagataatttcgggtttgatcga
ttgggtgttcgggttccaacgattgtggtctcgccttggatcaagagaggaacagttgtg
aacaagccaaaaggacctgcggaaaactcagagttcgagcactcttcaatacctgcaacg
ataaagaagatgttcaatctcacctcaggcttcttgacacaaagagatgcttgggctggg
acttttgaaggagtcgttactgagctaacttcgcctcgaacagactgtccgttggtttta
ccggatgttcctcctctgaggacaactcaagcagatgaagaccgttatgtttcagagttt
caaagtgagatagtcgagttggcttctaccctcaacggtgatcattcgttgaacattgaa
agccttgaaacgaaaaggagaatgaaagtaaaggaagccgatgggtatgttgatcgtgca
atctctagcttctttaaggcatgtgaagaagccatcagcatgggcttggaggaatcgacg
atagtgaacttggaagcatcggatactacgacaggagctccatga

DBGET integrated database retrieval system