KEGG   Asparagus officinalis (garden asparagus): 109825742Help
Entry
109825742         CDS       T05243                                 

Definition
(RefSeq) non-lysosomal glucosylceramidase-like
  KO
K17108  non-lysosomal glucosylceramidase [EC:3.2.1.45]
Organism
aof  Asparagus officinalis (garden asparagus)
Pathway
aof00511  Other glycan degradation
aof00600  Sphingolipid metabolism
aof01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aof00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    109825742
  09107 Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    109825742
Enzymes [BR:aof01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     109825742
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DUF608 Glyco_hydr_116N Bac_rhamnosid6H EF-hand_5
Motif
Other DBs
NCBI-GeneID: 109825742
NCBI-ProteinID: XP_020248218
Position
10
AA seq 949 aa AA seqDB search
MLENGVCNGEKRSLLNPSAMLEDTHPVDMDLGLPAILTWQRKLDDEERSFSEFSMTMKEM
LYMGPFIFQLCLNYLRESARGRAATFNPFKKLLAVSSHGVPLGGIGAGSIGRSYKGYFQH
WQLFPEICDESPVLANQFSVFVSRPDGKKYSTVLSPRSPDIPKGSTHPGIESWDWNLNGK
SSSYHALYPRSWTVYDGEPDPEIKITCRQISPFIPHNYQQSSLPVAVFTFTLANSGKTAA
DVTLLFTWANSAGGNSGFTGNHANSKMRERDGVRGVLLHHRTTNGQSPVTFAIAAQETED
VHVSECPYFSISGNSEPFTARDMWDEIKKNGSFDHLDIRENSLPSKEGSSVGAAVAASVT
IPSQSVRTVTFSLAWACPRVKFPSRKTYHRRYTKFYGIGGEAAANLVHDAISEHSHWESQ
IEDWQRPILQDKKLPPWYPVTLFNQLYYLNAGGTIWTDGLPPINSLAPLREKRFSIDMFT
AVTQVENTSSNILNKMSSTIANMLSPIASNSVFGTSLLHEGEENIGQLLYVEGLEYRMWN
TCDVHFYSSFALIMLFPKLELSIQRDFAAAVMMNDPEKMQIVFGREWVPRKVLGAVPHDV
GQNDPWFEVNSYNLHDSNRWKDLNPKFVLQVYRDAVATGDKNFARAVWPSVYVAMAYMDQ
FDKDRDGMIENEGFPDQTYDVWSVKGVSAYTGGIWVAALQAASALARIVGDRDSEEYFWN
RYQKAKNVYEKLWNGSYFNYDNSGGSTSSYIQADQMAGQWYAKACGLLPIVDEEKARSAL
EKVYSYNVLKYKDGKRGAVNGMKPDGTLDLSIMQASEVWSGSTFAVAAAMIQEGMVETGF
KTAQGVYEAAWSPEGIGYSFQTPEAWNPRDEYRSLNYMRPLSIWAMQWALSPPKLHKEEP
RTADIEEKDTPLENIEFSKIAELLTLPGEKTARSALGVLYEIICQKLRG
NT seq 2850 nt NT seq  +upstreamnt  +downstreamnt
atgttagagaatggagtttgcaatggggaaaagcgttctttgttgaatccttcagctatg
ttggaagatactcatccggtcgatatggatctggggctacctgccatattgacttggcaa
agaaagctagacgacgaggagcgtagtttctctgagttttccatgactatgaaagagatg
ttatacatgggtccctttattttccaattgtgccttaactatcttagagaatctgcaaga
ggacgggctgcaacatttaaccccttcaagaaactcttagctgtgtcttctcatggcgtt
cccttaggtggcattggtgcaggaagtataggaagaagctacaaaggttattttcaacat
tggcaattgttccctgaaatatgtgacgagagccctgtcttagcaaatcagttttcagtt
tttgtttcacgccctgatggcaagaagtattctactgtcttgtcacccagaagcccagat
attcctaaaggaagtacccatcctggaattgaatcatgggactggaatctgaatggaaaa
agttcatcatatcatgctttgtatccaagatcatggacagtgtatgatggtgaacctgac
ccagaaatcaaaattacatgccgccagatttcaccttttattccccacaattatcagcag
agcagcctcccagttgcagtgtttacattcacattagctaattctggaaagactgctgca
gatgtaactctgctttttacatgggctaattccgcaggtgggaactctggatttactggg
aatcatgccaattctaaaatgagagaacgagatggtgtccgtggcgtacttctacatcac
agaaccacaaatggtcaatctcctgttacttttgcaatagcagctcaagagacggaggat
gttcatgtttcagaatgtccttacttctcgatatctggaaactccgagccattcacagca
agggacatgtgggatgaaataaagaagaatggatccttcgatcaccttgatataagagaa
aattcattgccttcgaaggaaggatcatctgttggagcagcagttgcagcttcagtgaca
ataccatctcagtctgtccgtacagtcacattctctcttgcatgggcttgccctagggta
aagtttccaagcagaaagacttaccacaggaggtataccaaattctatggcattggtggc
gaagcggcggcaaatcttgtgcatgacgctatttctgagcatagccattgggaatcccaa
attgaagactggcaacggccgattttgcaggataagaaacttccaccgtggtaccctgtg
actcttttcaatcagctttactatcttaatgctgggggaacaatttggacagatgggctg
cctccaattaacagcttagcaccattaagggaaaagaggttctccatcgatatgtttact
gctgttactcaagtagagaatacctcctcaaatatcttaaacaaaatgtcatccacaatt
gctaatatgttgtctcctattgcatcaaattctgtttttggtacgtcattgctccatgag
ggagaagaaaatattggtcagttgctctatgttgaaggtcttgaatatcgaatgtggaac
acttgcgatgtccatttctactcgtcttttgctctaatcatgctatttcccaaacttgaa
cttagtatccaaagagactttgctgcagcagtaatgatgaatgatcccgagaaaatgcag
attgtgtttggccgcgagtgggtaccaaggaaagttcttggtgcagttcctcatgatgtt
ggccaaaatgacccgtggtttgaagtaaactcatataatcttcatgattcaaataggtgg
aaagatttgaacccgaagtttgtactccaagtttatagagacgcggttgccacaggtgac
aagaattttgcaagagcagtttggccttctgtgtatgtagcaatggcctatatggatcag
tttgacaaggacagagatggaatgatagaaaatgaaggtttccctgatcaaacttatgat
gtatggtcagttaaaggtgtgagtgcgtacactggtgggatttgggtcgctgctctgcag
gctgcttctgcattggcacgtatagttggtgatagagattctgaagaatatttttggaat
aggtatcagaaagcaaaaaatgtttatgagaaattgtggaatggttcttacttcaattat
gataacagtggaggcagtacaagctcatatatacaggctgaccagatggctggacaatgg
tatgctaaagcatgtggtctccttccaattgttgatgaggagaaagcacgtagtgcactt
gaaaaggtttattcctacaatgtcctaaaatacaaagatgggaagcgtggagcagtaaac
gggatgaaaccagatggtactctggatttatcaataatgcaagcatctgaagtgtggtct
ggctcgacatttgctgttgcagctgctatgattcaagagggcatggtagagacaggattt
aaaaccgcacaaggggtttatgaagctgcttggtctccagaaggaatagggtactctttt
cagacacctgaagcatggaatccaagggatgagtacaggtctctgaactatatgcgtcct
ctgtctatatgggctatgcaatgggcattatcaccgccgaagctacacaaggaagaacca
aggaccgccgatatagaggagaaggatacgccattagaaaacattgagttctctaaaata
gcagagctattgacattgccaggagaaaagactgctagaagtgcccttggagtcctctat
gaaattatctgtcagaagctaagagggtga

DBGET integrated database retrieval system