KEGG   Asparagus officinalis (garden asparagus): 109826328Help
Entry
109826328         CDS       T05243                                 

Definition
(RefSeq) beta-fructofuranosidase, insoluble isoenzyme 1-like
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
aof  Asparagus officinalis (garden asparagus)
Pathway
aof00052  Galactose metabolism
aof00500  Starch and sucrose metabolism
aof01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aof00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    109826328
   00500 Starch and sucrose metabolism
    109826328
Enzymes [BR:aof01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     109826328
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C
Motif
Other DBs
NCBI-GeneID: 109826328
NCBI-ProteinID: XP_020248938
Position
10
AA seq 576 aa AA seqDB search
MANSYRVMWVLFLLVQFLCNRAADGSHILANIKEHLESVPATVIDNKYRTGYHFQPRNMW
MNDPNGPMYYKGFYHLFYQYNPNHAFWEAPIWAHSVSKDMINWEALEPAISMSKPFDLSG
CWSGSTTILPGNRPVILYTGIDTRGYQVQNVAYPKNLSDPYLREWVKPDYNPLITPPEDI
NVTKFRDPTTAWLGPDRRWRLVIGGLRKHRGMAVLYKSKDFIRWIRAKHPLHSAPDTGMW
ECPDFYPVSTEGKLGVDTSDYRNGLKHVLKISLDRDRWDYYTIGSYNYTAEKFVPDGMMV
DNRTGLRYDYGNYYASKTFFDVATKRRILMGWSNESDSKIDDIVKGWAGILTVPRAIWLD
ANGRQLVQWPIKELEKLRGALFSVQNKKLQSGGLVEISGISAAQADIEVDFELSNLAKAE
TFDPLWTDPQKLCEENDSDVKGGVGPFGLLTLASDKREEQTAVFFRIFKATHKYVVLMCH
DPSRSSLRPGLYKPTYGGFVDIEIQKNGKISLRSLIDHSVVESFGGEGRTCMTSRIYPTL
AVGDSSHLFVFNNGAEDVKILKLDAWEMRKPLMNGE
NT seq 1731 nt NT seq  +upstreamnt  +downstreamnt
atggcgaactcatatagagttatgtgggtattatttttgttagtgcaatttttgtgtaat
agggctgctgatggctctcatattctcgctaatataaaagaacatttggaatcagtcccg
gccaccgttatcgataataaatataggactggttatcatttccaacctcggaatatgtgg
atgaatgatccaaatgggccaatgtactacaaaggtttctaccatttattctaccaatac
aatcctaatcacgcattttgggaagcccctatttgggctcactcagtctcaaaggacatg
atcaattgggaggcactcgaacccgcgatctccatgtccaaacccttcgacctttcaggt
tgttggtctgggtccactaccatcctacccggtaacagacctgttatcctttacactggc
attgacacgcgtggctaccaagtacagaatgttgcgtaccccaaaaacctatctgacccg
tatcttcgcgaatgggtcaagcctgattacaatccgttaattaccccccctgaagatatc
aatgttactaagtttcgtgatccgacgacagcctggctgggccctgatcgccgttggagg
ttagtcatcggggggttaaggaaacatcgagggatggcagtgctgtataaaagcaaagat
ttcatccgttggattcgggcaaaacacccactacactcagccccagatacgggtatgtgg
gagtgcccggatttttatccggtgtccacggagggtaaattgggcgtagacacttcagat
taccgtaacgggttgaagcatgtactgaaaattagcttggatagagacagatgggattat
tatactattggttcgtacaactacactgcagaaaaatttgtcccagatggtatgatggtg
gataaccgtacaggattaagatatgattatggtaactactacgcttcaaagacatttttt
gatgtggctactaaaaggaggatcttgatggggtggtctaatgagtcagatagcaaaatt
gatgatatcgttaagggttgggctggtattctgacagttccgagagctatttggcttgat
gcaaatggtcggcaactagttcagtggcccattaaagagcttgagaaacttagaggggca
cttttttcagtacagaataagaaactgcagagtggcggacttgttgaaatctcaggaata
tcagctgcacaggcagatatagaggtggattttgagttatcaaacctagcaaaggctgag
acatttgatccactttggactgatcctcaaaaactatgtgaagaaaatgattcagatgta
aagggtggggttggaccctttggacttctaaccctagcttcagacaagagagaggagcaa
actgctgtgttctttagaatttttaaagctactcacaagtatgtggttctaatgtgtcat
gatccatcaaggtcttcattgaggccaggactttataaaccaacctatggtggttttgtt
gatattgagattcagaagaatggcaagatttccctaagaagtttgattgatcattctgtg
gtggagagctttggaggtgaaggaagaacttgtatgacatcaagaatttatcccacactt
gcagtaggagactcttctcacctattcgtctttaataacggagcagaagatgtgaaaatc
ttaaagctcgatgcatgggaaatgaggaagcctttgatgaatggagaatag

DBGET integrated database retrieval system