KEGG   Asparagus officinalis (garden asparagus): 109827059Help
Entry
109827059         CDS       T05243                                 

Definition
(RefSeq) G-type lectin S-receptor-like serine/threonine-protein kinase At2g19130
  KO
K04733  interleukin-1 receptor-associated kinase 4 [EC:2.7.11.1]
Organism
aof  Asparagus officinalis (garden asparagus)
Brite
KEGG Orthology (KO) [BR:aof00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:aof01001]
    109827059
Enzymes [BR:aof01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     109827059
Protein kinases [BR:aof01001]
 Serine/threonine kinases: TKL group
  IRAK family
   109827059
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr APH Seadorna_VP7 Kinase-like Pox_ser-thr_kin
Motif
Other DBs
NCBI-GeneID: 109827059
NCBI-ProteinID: XP_020249614
Position
Unknown
AA seq 223 aa AA seqDB search
MPMGSLDHHLFQKQSKNLDWKTRYQIILGTARGLAYLHEECRECIIHCDIKPENILLDTE
FCPKLSDFGMAKLIGHDFSRVLTTMRGTIGYLAPEWIEGLPITPKADVYSYGMMLFEIVS
GRRNSKLAEGGTIRYFPVQAASKVITGEVLSLLDEDLNGSADASELNRVCRVACWCIQDF
EADRPSMAEVVKNLEGVLDLKMPPFPTILQRLAEEVSVLSYNE
NT seq 672 nt NT seq  +upstreamnt  +downstreamnt
atgccaatgggatctttggatcaccacctctttcaaaaacaatccaagaatttagactgg
aagactagatatcagatcatactaggcactgccaggggattggcatatctccatgaagaa
tgtagagaatgcatcatccactgtgatataaaaccagaaaacattctattagatactgaa
ttctgtccaaaattatcagactttggaatggcaaagctcattggccatgacttcagccga
gtactaacaacgatgaggggaactataggctatctagcaccagaatggatcgaagggcta
ccaataacacccaaagcagatgtctatagctatggtatgatgctatttgaaatagtatct
ggtagaagaaactcaaaattggctgaaggagggaccatcaggtattttcctgttcaggct
gcgagcaaagtcatcacaggggaagttcttagcttactagatgaggatttgaatggttct
gcggatgcttcggagctgaacagagtctgcagagttgcttgctggtgcattcaagatttt
gaggcagataggccatcgatggctgaagttgtcaaaaacttggaaggggttttagatctg
aagatgcctccgtttcctacaattcttcaacgtcttgctgaggaagtttctgtacttagt
tacaatgagtaa

DBGET integrated database retrieval system