KEGG   Asparagus officinalis (garden asparagus): 109827785
Entry
109827785         CDS       T05243                                 

Definition
(RefSeq) delta(14)-sterol reductase
  KO
K00222  Delta14-sterol reductase [EC:1.3.1.70]
Organism
aof  Asparagus officinalis (garden asparagus)
Pathway
aof00100  Steroid biosynthesis
aof01100  Metabolic pathways
aof01110  Biosynthesis of secondary metabolites
Module
aof_M00917  Phytosterol biosynthesis, squalene 2,3-epoxide => campesterol/sitosterol
Brite
KEGG Orthology (KO) [BR:aof00001]
 09100 Metabolism
  09103 Lipid metabolism
   00100 Steroid biosynthesis
    109827785
Enzymes [BR:aof01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.70  Delta14-sterol reductase
     109827785
SSDB
Motif
Pfam: ERG4_ERG24 DUF1295 OPA3
Other DBs
NCBI-GeneID: 109827785
NCBI-ProteinID: XP_020250392
Position
Unknown
AA seq 371 aa
MEEAAAALITSLIPTWSAVIVLFSYLGYLALAGSLLPGKIVPGAVLSDGSRLRYHCNGLL
SLVLLMALLGVGVQMELVSPTVVADKGLELLSVTFIFSVLVSLILYAMGRSSCDQSSSFK
PHITGNMLDDWWLGAQLNPRFMGIDLKFFFVRAGMMGWLFINLSLLAKLYQAGNVNLSVI
LYQLFCGLYVIDYFFNEEFMTSTWDIIAERLGFMLVFGDLVFIPFTFTIQGWWLLKNKVE
LSKIAAISSCLVFLIGYQVFRGANKQKHVFKKDPKARIWGRPPKVIGGKLLASGYWGIAR
HCNYLGDLLLALSFSLPCGTSSVIPYFYPIYLLILLIWRERRDEARCSQKYKEIWAEYCQ
LVPWRILPFVY
NT seq 1116 nt   +upstreamnt  +downstreamnt
atggaggaagcagcagcagccctcatcacttctttgatccccacatggagcgctgtgatt
gtgctgttctcttatttgggttacttggcattggctggatctcttcttcctggcaagatt
gtcccgggtgctgtcctctccgatggctcccgcctccgatatcactgcaacggtttattg
tcacttgttttgttgatggcccttcttggggttggggttcaaatggagttggtttctcct
acggttgtagcagataaaggacttgaactgctatctgttacttttatattcagtgtcttg
gtatctctgatactctatgctatgggtcgcagctcttgtgaccagagttcctccttcaaa
cctcacatcacaggaaacatgctcgatgattggtggttaggggcacagctgaaccctcga
tttatgggaatcgacctcaaattcttttttgttagagctggaatgatgggatggttattc
attaacctctctttgttagcaaaactctaccaagctggcaatgtcaacctttcggtcatt
ctttaccagctcttttgtgggctttacgttatagattacttctttaatgaagagtttatg
acctcaacgtgggatatcattgctgagagattgggcttcatgttggtttttggagacctg
gttttcattcctttcacatttacaattcagggttggtggcttctgaaaaacaaagttgaa
ctatcaaaaatagctgccatatctagttgcctagtttttctcattggctatcaagtattt
cgaggcgccaacaaacaaaaacatgtatttaaaaaggaccctaaagctcgcatatggggt
aggcctccaaaagtcattggaggcaaactactagcttctggttactggggaattgcaagg
cactgtaattaccttggagatttgcttctagcactttcattcagcttaccatgcggaaca
agttctgtgattccctacttctatcctatatatcttctcatacttcttatatggagggag
agaagagatgaagcaagatgctcacagaaatacaaagaaatctgggcagaatactgccaa
cttgttccttggaggatactgccgtttgtttactag

DBGET integrated database retrieval system