KEGG   Asparagus officinalis (garden asparagus): 109829208Help
Entry
109829208         CDS       T05243                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: 18.2 kDa class I heat shock protein-like
  KO
K13993  HSP20 family protein
Organism
aof  Asparagus officinalis (garden asparagus)
Pathway
aof04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:aof00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    109829208
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:aof03110]
    109829208
Chaperones and folding catalysts [BR:aof03110]
 Heat shock proteins
  HSP20
   109829208
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HSP20 ArsA_HSP20 FKBP26_C MOSC_N CS
Motif
Other DBs
NCBI-GeneID: 109829208
NCBI-ProteinID: XP_020251955
Position
1
AA seq 150 aa AA seqDB search
MALIPRISGQRSNVFDPFSLDVWDPFQGWPFDSSRSLADPPAXRIDWKETPEAHVFKADL
PGMKKEEVKVEVEEGRVLQISGERSKEQEEKNDRWHRVERSSGKFLRRFRLPENAKMDQV
KATMENGVLTVTVPKEEVKKPEVKAIEISG
NT seq 453 nt NT seq  +upstreamnt  +downstreamnt
atggctctgattcctcgaatctccggtcagaggagcaacgtcttcgaccccttctccctc
gacgtctgggacccttttcagggctggcctttcgactcttctcgctcgctagccgatccg
ccagcancccgcatcgactggaaagagacgcccgaggcccacgtcttcaaggccgacctc
ccggggatgaagaaggaagaggtgaaggttgaggtcgaggaaggaagggttctgcagatc
agcggagagcggagcaaggagcaagaggagaagaatgacaggtggcacagggtcgagagg
agcagcggcaagttcttgaggaggttcaggctgccagagaacgcgaagatggatcaggtg
aaggcgacaatggagaacggcgtgctcacggtgaccgtgccgaaggaggaagtcaagaag
cccgaggtgaaagccattgaaatttctggctag

DBGET integrated database retrieval system