KEGG   Asparagus officinalis (garden asparagus): 109829570Help
Entry
109829570         CDS       T05243                                 

Definition
(RefSeq) probable protein S-acyltransferase 16
  KO
K20029  palmitoyltransferase ZDHHC3/7/25 [EC:2.3.1.225]
Organism
aof  Asparagus officinalis (garden asparagus)
Brite
KEGG Orthology (KO) [BR:aof00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:aof04131]
    109829570
Enzymes [BR:aof01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.225  protein S-acyltransferase
     109829570
Membrane trafficking [BR:aof04131]
 SNARE
  SNARE associated proteins
   Palmitoyltransferases
    109829570
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DHHC DUF588 MscS_TM T_cell_tran_alt DUF1980
Motif
Other DBs
NCBI-GeneID: 109829570
NCBI-ProteinID: XP_020252232
Position
2
AA seq 244 aa AA seqDB search
MAGSAARCSRGGGRCPVATYGIAVVRDPGSVPSSFVPDIEDTSSPVHEIKRKGGDLRYCQ
KCSHYKPPRAHHCRVCKRCVLRMDHHCVWINNCVGHANYKVFLVFVLYAVIACIHSMVLL
FGSVVHDMHKDQQQNGGSFRTSYIICGVLLIPLTLALSVLLGWHIYLILHNKTTIEYHEG
VRAMWLAEKVGNIYRHPYDLGVYDNLVSVLGPNIFCWLCPITRHNGSGVRFRTSYDLTFP
ATPR
NT seq 735 nt NT seq  +upstreamnt  +downstreamnt
atggcgggatcggcggcgcggtgttcacgcggtggcgggcggtgtcccgtggcgacgtat
gggattgcggtggtcagggatcctgggagcgttccgagctcgttcgtgccggatatcgag
gatacttcgagtccagtgcatgagatcaagaggaagggtggagacttgagatattgtcaa
aagtgctctcattataaacctcctcgtgcgcaccattgtcgtgtttgcaaaaggtgtgtt
ctgaggatggaccatcactgtgtctggataaataattgtgttgggcatgcaaattacaaa
gttttcttagtttttgtgttgtatgctgtgattgcctgcattcactctatggttcttctc
tttggcagtgttgttcatgatatgcacaaggatcaacagcagaatggaggctcttttagg
acatcatatattatttgtggtgttttgcttattccccttacattggcgttaagtgttctt
ttgggttggcatatctatctgatcttgcataataagacaactatagagtatcatgaagga
gtgagggccatgtggttggcagaaaaagttggaaatatttatagacatccatatgacctt
ggtgtctatgataacctagtttcggttctcggtccaaacatattctgttggctttgcccc
ataacaagacataacggttctggtgtccgtttcaggacttcttatgacctaacatttccc
gcgacgccaaggtaa

DBGET integrated database retrieval system