KEGG   Asparagus officinalis (garden asparagus): 109830085Help
Entry
109830085         CDS       T05243                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: multiple inositol polyphosphate phosphatase 1-like
  KO
K03103  multiple inositol-polyphosphate phosphatase / 2,3-bisphosphoglycerate 3-phosphatase [EC:3.1.3.62 3.1.3.80]
Organism
aof  Asparagus officinalis (garden asparagus)
Pathway
aof00010  Glycolysis / Gluconeogenesis
aof00562  Inositol phosphate metabolism
aof01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aof00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    109830085
   00562 Inositol phosphate metabolism
    109830085
Enzymes [BR:aof01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.62  multiple inositol-polyphosphate phosphatase
     109830085
    3.1.3.80  2,3-bisphosphoglycerate 3-phosphatase
     109830085
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: His_Phos_2
Motif
Other DBs
NCBI-GeneID: 109830085
NCBI-ProteinID: XP_020252825
Position
2
AA seq 497 aa AA seqDB search
MAIPLAVLTLTLFSSLLPSSSSVGGSFDVRHHLSTVTRYDAGKEANVAVYQPPAVPDGCT
PFHLNLVARHGTRAPTKKRIQELDRLAIRLESLLSEAKQAGRSIPSWLSGWKSPWKGRKR
GGELVSEGEXXXXXELFKEEYHPDVFTIRATQVTRASASAVAFGIGLFSGKGSLGPGRHR
AFSVISESRASDIWLRFHDNCETYKQYRKSQEPAVGKLKEPILDEVTSALVKRYHLNFTR
QDIASLWFLCKQEASLLQITDQACGLFSASEVSLLEWTDDLEVFLLKGYGNSINYHMGIP
LLKDIHQSIEQAIAAREENLTPGTFEKARLRFAHAETVIPFICLLGLFLEEHEFEKIQHD
KPLDHPPKPPQGRNWRGSTIAPFAGNSMLVSFHCPGNDSNGIITPEGYRSKYFVQVLHNE
VPVPMPGCGNKEFCPLEVFKEKIVNPHLTHEFETVCKPKSDLPPKPHSLFSKLLNWFYRR
YFQNDISKTTGSRKTEL
NT seq 1494 nt NT seq  +upstreamnt  +downstreamnt
atggcgatccccctcgccgtcctaaccctaactctcttctcgagccttctcccttcttct
tcctccgtcggcggatccttcgacgtccgccaccacctttccaccgtcaccagatatgat
gctggaaaagaagcaaacgttgctgtttaccagccacctgctgtcccggatggatgtacc
ccatttcacctgaatcttgtggcaagacatggaacccgtgctcctaccaaaaaaaggatt
caagaattagatcggctggcaattcgtttggagtcacttctcagtgaagcaaaacaggct
ggacggagtattccttcatggttgtctggttggaaatccccttggaaaggtagaaagaga
ggtggagagctggttagtgaaggagagnnannnnnnnnnncagaactgtttaaagaggag
tatcacccagatgtttttacaataagagcaacccaggttactcgagcatcagctagtgct
gtggcatttggcattgggctattttctggaaaaggatcccttgggccagggcggcatcgt
gcattttctgtgataagtgagagtcgtgcaagtgatatatggctacggtttcatgataac
tgtgaaacatacaagcaatataggaaaagtcaggaacctgccgttggtaaacttaaagaa
ccgattttagatgaagtcactagtgcgctggtcaagcggtatcatctgaatttcactagg
caggatatcgcctccctctggttcctctgcaaacaggaagcatctttgttgcaaattact
gaccaagcttgtggtcttttcagcgcttctgaggtttcgttgctcgagtggactgatgac
ttggaggtattccttttaaaaggttatggaaattcgataaattatcacatgggaatacct
ttacttaaagatattcatcagtcaatagagcaggcgattgcggctagagaagaaaacctt
acccctggaacatttgagaaggcaaggctccgatttgctcatgctgagacggttataccc
ttcatttgtcttctagggctctttcttgaagaacatgaatttgaaaagattcaacatgat
aagccattggatcaccctccaaagcctcctcagggaagaaattggaggggcagtacaata
gcaccatttgctggaaatagtatgttggtttcattccattgtccaggcaatgattcaaac
ggcatcatcacacctgaaggttacaggagcaagtattttgtgcaagttctgcacaatgaa
gttccggttcccatgccgggatgcggcaacaaagagttctgcccgcttgaggttttcaag
gaaaaaattgtcaatcctcatttgacccatgagtttgagactgtgtgcaaaccaaaatcg
gatctgccaccaaaaccccattccttattctcaaagctcttaaattggttctataggcga
tatttccagaacgatattagcaaaactacgggaagtcggaagacagagttgtga

DBGET integrated database retrieval system