KEGG   Asparagus officinalis (garden asparagus): 109830513Help
Entry
109830513         CDS       T05243                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: glucose-6-phosphate 1-dehydrogenase, cytoplasmic isoform
  KO
K00036  glucose-6-phosphate 1-dehydrogenase [EC:1.1.1.49 1.1.1.363]
Organism
aof  Asparagus officinalis (garden asparagus)
Pathway
aof00030  Pentose phosphate pathway
aof00480  Glutathione metabolism
aof01100  Metabolic pathways
aof01110  Biosynthesis of secondary metabolites
aof01200  Carbon metabolism
Module
aof_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
aof_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
Brite
KEGG Orthology (KO) [BR:aof00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    109830513
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    109830513
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:aof04147]
    109830513
Enzymes [BR:aof01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.49  glucose-6-phosphate dehydrogenase (NADP+)
     109830513
    1.1.1.363  glucose-6-phosphate dehydrogenase [NAD(P)+]
     109830513
Exosome [BR:aof04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   109830513
  Exosomal proteins of colorectal cancer cells
   109830513
  Exosomal proteins of bladder cancer cells
   109830513
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: G6PD_C G6PD_N DUF4187
Motif
Other DBs
NCBI-GeneID: 109830513
NCBI-ProteinID: XP_020253375
Position
2
AA seq 543 aa AA seqDB search
MSTGSNGSSPSSKSDSFERNSFRSESFIEDRPLDDVLESGCLSIVVLGASGDLAKKKTFP
ALFNLFRQGFLQSNEVHIFGYARSKITNEELRERIRGYLSPEKGASAEQSDVLEKFLKLI
KYVSGPYDCPDGFRLLDKEISEHEISKNSQPGTSRRLFYLALPPSVYPSVCRMIKSYCMN
QSDLTGWTRIVVEKPFGKDLGSAEELSSQLGELFDEQQXXXXVHVKREELXYCFFCTSTD
HFLHLLLHDQLVLRFANRLFLPLWNRDNIDNIQIVFREDFGTEGRGGYFDEYGIIRDIIQ
NHLLQVLCLVAMEKPVSLKPEYIRDEKVKVLQSVLPISLDEVVLGQYEGYKDDPTVSDSS
NTPTFATVVMRIHNERWEGVPFILKAGKALNSKKAEIRVQFKDVPGDIFKCKKQGRNEFV
IRLQPSEAMYMKLTVKKPGLEMSTIQSELDLSYGMRYQGVPIPEAYERLILDTIRGDQQH
FVRRDELRAAWEIFTPLLHRIDDGELKPLPYKPGSRGPEKADELLAKAGYVQTHGYIWIP
PTL
NT seq 1632 nt NT seq  +upstreamnt  +downstreamnt
atgtcaacaggatcaaatgggtcatcaccttcgtcaaaaagcgactcctttgagagaaac
agctttaggagtgaatctttcattgaggacagacccctcgacgatgtattagagagcggg
tgcctgtccattgttgtgcttggtgcttccggagatctggcaaagaagaaaacttttcct
gcgctctttaaccttttccggcagggtttcttacaatccaatgaagttcacatctttgga
tatgcccgatcaaagatcactaatgaagaattaagagaacgaatacgtggttatcttagc
ccagagaaaggagcttctgctgagcaatctgacgttctggagaagttccttaaattgatc
aagtatgttagcggtccatatgactgtccagatgggtttagattgctggataaggaaatt
tcagagcatgagatatcaaaaaatagtcaaccgggaacctctcgcagactgttttatctt
gccttacctccatctgtttacccttctgtctgcagaatgattaaaagttattgcatgaac
cagtctgatcttaccggctggactcggattgttgttgagaagcctttcggaaaggatctg
ggctctgctgaagaactaagttcccagctcggggagttatttgatgagcagcagnnnnnn
nnnngtgtgcatgttaaaagagaggagctgtgatactgtttcttttgtacctccactgat
catttcttgcatctccttttgcatgaccagttggtacttcgttttgcaaatcgcttgttt
ttacctctttggaatcgtgacaacatcgataacatacagattgtcttcagggaggatttt
ggaactgaagggcgtggaggatatttcgatgaatatggaataattcgcgatatcattcaa
aatcatctgttgcaggttctttgtttggtggcaatggagaagcccgtttctcttaagccc
gagtacatacgggatgagaaagtgaaggttcttcaatcagttcttccaatatcactcgat
gaggttgtcctagggcaatatgaaggctacaaagatgatccgacagtttcagatagctct
aatactcctacttttgcaactgtggttatgcggatacacaatgaaagatgggaaggtgtt
ccttttatactcaaggcaggaaaagctttgaattcaaaaaaagcagaaattcgtgttcag
ttcaaagacgttcctggtgatatctttaaatgtaaaaagcaaggcagaaatgaatttgtt
atacgtctgcaaccttcagaagctatgtacatgaaactgactgtcaagaaacctggattg
gaaatgtcaaccatacaaagtgaactagatttgtcttatggaatgcgataccaaggtgtc
ccaattcctgaggcatatgaacggttgatattggacacaatacgaggagaccagcaacat
tttgtgcgcagagatgaacttagggcagcatgggagatcttcacacctttacttcacaga
attgatgatggagagctgaagcctctcccttacaaacccggcagcagaggaccagaaaaa
gccgatgaattgcttgctaaagctgggtacgtgcagacgcacggatacatatggataccg
cctaccctataa

DBGET integrated database retrieval system