KEGG   Asparagus officinalis (garden asparagus): 109830688Help
Entry
109830688         CDS       T05243                                 

Definition
(RefSeq) probable methylenetetrahydrofolate reductase
  KO
K00297  methylenetetrahydrofolate reductase (NADPH) [EC:1.5.1.20]
Organism
aof  Asparagus officinalis (garden asparagus)
Pathway
aof00670  One carbon pool by folate
aof01100  Metabolic pathways
aof01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:aof00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    109830688
Enzymes [BR:aof01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.20  methylenetetrahydrofolate reductase [NAD(P)H]
     109830688
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MTHFR
Motif
Other DBs
NCBI-GeneID: 109830688
NCBI-ProteinID: XP_020253630
Position
1
AA seq 210 aa AA seqDB search
MRIDHRAWTPARGGEGFSSGLDLVKYIRKKHGDYFGICVAGYPEAHPSQIPDGAEVATEE
GYAADLDYLKKKVDAGADFIITQLFFDAQVFIKFVKDCRRIGIRCPIIPGILPITTYRNF
KFMTETCKTKVPKEVRAAVDAAKGDDKKLAEYGVELATKICREILKETGVRALHFYTMNK
EAPALGVLRNLGLVAAPAAAENGKVAAVKM
NT seq 633 nt NT seq  +upstreamnt  +downstreamnt
atgaggatcgaccaccgcgcgtggacaccggcacgcggaggggaggggtttagtagcggg
ctggatcttgtgaagtatattaggaagaagcatggggattattttgggatttgcgttgct
gggtacccagaagcccacccatctcagatacccgacggcgccgaggtcgccaccgaagag
ggctacgcggccgacctcgactacctcaagaagaaagtcgacgccggtgcagacttcatc
ataacccagctcttcttcgacgcccaagtattcatcaagttcgtcaaagactgtcgtcgc
atcggaatccgatgcccgataatccccggaatcctccccatcacaacctacagaaacttc
aagttcatgaccgagacctgcaagaccaaggtccccaaagaggtccgcgcagctgtggac
gcggcgaaaggcgacgacaaaaagctggcagagtacggagtggagctggccaccaagatt
tgtagggagatactgaaggagaccggagtgagagcgctgcatttttatacgatgaacaag
gaggcgccggcgctgggagtgctgaggaatttagggttggttgctgctcctgctgctgct
gagaatggaaaggttgctgcagtgaagatgtag

DBGET integrated database retrieval system