KEGG   Asparagus officinalis (garden asparagus): 109831723
Entry
109831723         CDS       T05243                                 

Definition
(RefSeq) delta(14)-sterol reductase-like
  KO
K00222  Delta14-sterol reductase [EC:1.3.1.70]
Organism
aof  Asparagus officinalis (garden asparagus)
Pathway
aof00100  Steroid biosynthesis
aof01100  Metabolic pathways
aof01110  Biosynthesis of secondary metabolites
Module
aof_M00917  Phytosterol biosynthesis, squalene 2,3-epoxide => campesterol/sitosterol
Brite
KEGG Orthology (KO) [BR:aof00001]
 09100 Metabolism
  09103 Lipid metabolism
   00100 Steroid biosynthesis
    109831723
Enzymes [BR:aof01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.70  Delta14-sterol reductase
     109831723
SSDB
Motif
Pfam: ERG4_ERG24 DUF1295
Other DBs
NCBI-GeneID: 109831723
NCBI-ProteinID: XP_020254708
Position
1
AA seq 386 aa
MNSETNNIRSFNTASYNIFSTPXLSSSIPTWSSVMVLFSYLGYLALAGSILPGKIVPGAV
LSDGTRLHYRCNGLLSLLVLLALLGVGVQMKLISPTVIADKGLELLSVTFIFSILVSLVL
YVAGCKSNDKSSSFKPHVTGNMLDDWWLGVQLNPRFMGIDLKFFFVRAGMMAWLFINLSL
FAKLYQAGNANLSVILYQLFCGLYVIDYFFYEEFMTSTWDIIAERLGFMLVFGDLVFIPF
TFTIQGWWLLKHKVEISKLAAAVSCLVFFIGYQVFRGANKQKHVFKKNPKAHIWGKPPKV
IGGKLLASGYWGIARHCNYLGDLLLALSFSLPCGTSSVIPYFYPIYLLILLIWRERRDDT
RCSEKYKEIWEEYCKLVPWRILPFVY
NT seq 1161 nt   +upstreamnt  +downstreamnt
atgaacagtgaaaccaacaatattcgttcttttaataccgcctcgtataatatattcagc
acgcccntccttagttcatcaatccccacatggagctccgtgatggtcctgttctcctac
ttgggctacttggcattggcggggtctattctccccggcaagatcgtccctggtgccgtg
ctctctgatggcactcgcctccattatagatgcaatggattattatcacttctcgtcttg
ttggcacttctaggggtcggtgttcaaatgaagttgatctctcctacggtcatagcagac
aaaggacttgagcttctatcagttactttcatattcagcatcctggtatctctggtgctt
tatgttgctggttgcaagtctaatgacaaaagttcctccttcaaacctcatgtgacaggg
aacatgcttgatgattggtggttgggagtacagctgaatcctcgatttatgggaatagac
ctcaaattcttttttgtcagagctggaatgatggcatggttattcatcaatctctcttta
ttcgcgaagctctatcaagccggcaatgcaaacctttcagtcattctttaccagctcttt
tgtgggctgtacgttatagattacttcttctatgaagagttcatgacctccacgtgggac
attatagctgagaggctgggcttcatgctggttttcggggatctggtttttattcctttc
acgtttacaattcagggttggtggcttctgaaacataaagttgaaatatcaaaattagct
gctgcagttagttgcctggttttcttcatcggctatcaagtattccgtggagccaacaaa
caaaagcatgtattcaaaaaaaatcctaaagctcacatatggggcaagcctccaaaagtc
attggaggaaagctacttgcttctggttactggggaattgcaaggcactgtaattatctt
ggagatttgctcttagcactctcattcagtttgccttgtggaacaagttctgtgatcccc
tacttctatcctatatatcttcttatacttcttatatggagggagagaagagacgacaca
aggtgctctgagaagtacaaagagatatgggaagaatattgcaagcttgttccttggaga
atacttccatttgtttactaa

DBGET integrated database retrieval system