KEGG   Asparagus officinalis (garden asparagus): 109832790Help
Entry
109832790         CDS       T05243                                 

Definition
(RefSeq) probable bifunctional riboflavin biosynthesis protein RIBA 1, chloroplastic
  KO
K14652  3,4-dihydroxy 2-butanone 4-phosphate synthase / GTP cyclohydrolase II [EC:4.1.99.12 3.5.4.25]
Organism
aof  Asparagus officinalis (garden asparagus)
Pathway
aof00740  Riboflavin metabolism
aof00790  Folate biosynthesis
aof01100  Metabolic pathways
aof01110  Biosynthesis of secondary metabolites
Module
aof_M00125  Riboflavin biosynthesis, GTP => riboflavin/FMN/FAD
Brite
KEGG Orthology (KO) [BR:aof00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    109832790
   00790 Folate biosynthesis
    109832790
Enzymes [BR:aof01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.25  GTP cyclohydrolase II
     109832790
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.99  Other carbon-carbon lyases
    4.1.99.12  3,4-dihydroxy-2-butanone-4-phosphate synthase
     109832790
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DHBP_synthase GTP_cyclohydro2
Motif
Other DBs
NCBI-GeneID: 109832790
NCBI-ProteinID: XP_020255794
Position
3
AA seq 551 aa AA seqDB search
MASVSASSSVLRISYPQGNSCIGKVQRLQFINPSVNRIFSNATTISLKRATCFALQGDGG
FQTITRSDDDDILSHPSDTVNGDKNTSVDSMLQADDVAVGTNAADVASVTDEFSSYDDEV
DLDYPTEGFSSIPEAIEDIRQGKFVIVVDDEDRENEGDLIMAASKVTPEAMAFIVRHGTG
IVCVSMKEEDLERLHLPLMVTAKENEEKLCTAFTVSVDAKNGTTTGVSAKDRAKTILALA
DTSSRPEDFNRPGHIFPLKYREGGVLKRAGHTEASVDLTVLAGLSPVAVLCELVDEDDGS
MARLPKLREIAKRENLKIISIADLIRYRRKREKLVERASVARLPLKWGNVEAYCYRSLLD
GIEHIAMVKGNIGDGQDILVRVHSECLTGDIFGSARCDCGNQLAMAMELIEKHGRGVLVY
LRGHEGRGIGLGHKLRAYNLQDAGRDTVEANEELGLPVDSREYGIGAQILHDLGVRTMKL
LTNNPAKYSGLKGYGLSVVGRVPLLTLITKENQRYLETKRKKMGHIYGTEFNGRLIASPE
NKDSDKEQPSS
NT seq 1656 nt NT seq  +upstreamnt  +downstreamnt
atggcttccgtttctgcttcgtcttccgtcctcaggatctcttatcctcaggggaatagc
tgcattgggaaggtacaaaggctgcagtttattaatccttctgtgaataggatattttct
aatgcaacaacaatcagcctcaagagagcaacatgttttgctttgcaaggagatgggggt
tttcagacaataacaaggtctgatgatgatgacatcctgtcccatcctagtgatactgtc
aatggagataaaaatacatcagttgatagcatgcttcaagcagatgacgttgcagttggt
acaaatgcagctgatgtggcttctgtaactgatgagttttctagttatgacgacgaagtt
gacttagattaccctactgaagggttctcctcaatcccagaggccattgaagatattcgt
caaggcaagtttgtcattgttgtagatgatgaagatagggagaatgagggagatcttata
atggctgcatcgaaggttactccagaagctatggcttttattgtaagacacgggactgga
attgtgtgtgtaagcatgaaagaagaagacctggagaggttgcatcttcctcttatggta
acagccaaggaaaatgaggagaaactctgcacagcttttactgtttcagtggatgctaag
aatggtacaacaaccggggtctctgctaaagatagggctaaaacgattttggctcttgca
gatacttcttcaagacctgaggacttcaatcgccctggccatatatttcccttaaagtac
agggaagggggtgtattgaaaagagctggacatacagaagcgtctgttgacctcactgtc
cttgcagggttaagtcctgttgcagttctttgtgagttggtggatgaagatgatggttcg
atggctcgtttgccaaaacttcgtgaaattgcaaagcgggagaacttgaaaatcatatcg
attgcagacttgattagatataggaggaagagagagaagctggtggagcgtgcttcagtc
gcacgcttacctttaaaatggggcaatgttgaagcatattgctaccgatcattgcttgac
gggattgagcatattgccatggtgaaaggtaacataggagatgggcaggatatcttagtg
agggtacattctgagtgcctcacgggagacatatttggatcagctagatgtgattgtggt
aatcaattagccatggccatggagctgattgaaaagcacggaaggggtgtgctagtttac
cttcgtggtcatgaaggaaggggcattggactcggtcacaaactccgtgcttataactta
caagatgctgggcgtgacacagtggaagccaatgaagagttaggattgcctgtagattca
agggagtacggcattggcgcgcagatattgcacgatcttggcgttcggacaatgaagttg
ctgaccaacaacccggcaaaatatagcgggctcaaaggctatgggttgagcgtggttgga
agagtccctttattgactttaataaccaaagagaaccaaaggtatctagagaccaagaga
aaaaagatggggcacatctatggaactgaattcaacggccgcttgattgcttcacctgaa
aataaagacagcgacaaggagcagccatcttcataa

DBGET integrated database retrieval system