KEGG   Asparagus officinalis (garden asparagus): 109833241Help
Entry
109833241         CDS       T05243                                 

Definition
(RefSeq) external alternative NAD(P)H-ubiquinone oxidoreductase B3, mitochondrial-like
  KO
K17871  NADH:ubiquinone reductase (non-electrogenic) [EC:1.6.5.9]
Organism
aof  Asparagus officinalis (garden asparagus)
Brite
KEGG Orthology (KO) [BR:aof00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    109833241
Enzymes [BR:aof01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.5  With a quinone or similar compound as acceptor
    1.6.5.9  NADH:ubiquinone reductase (non-electrogenic)
     109833241
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox EF-hand_1 EF-hand_5 EF-hand_6 EF-hand_7 DAO p25-alpha EF-hand_8 MRP-S28
Motif
Other DBs
NCBI-GeneID: 109833241
NCBI-ProteinID: XP_020256429
Position
3
AA seq 578 aa AA seqDB search
MRVGAFFFDRASKALKNPTFTKLVVVFTVSGGGLVAYADSKSDIGSELSQASNRKKVVVL
GTGWAGTSFLKTLDSSLYDVQVISPRNYFAFTPLLPSVTCGTVEPRSIAEPIRNIIKKKK
ADIKFWEAECFKIDPKSKKVHCRSNIGTNLDGTGEFAVDYDYLVIAIGARPNTFNTPGVT
ENCHFLKEIEDAQRIRKSVMNCFEKAALPNLSEEERRKTLHFIVIGGGPTGVEFAAELHD
FVSEDLAKLYPNIRDLVKISLIEAGDHILTMFDKRITQFAEEKFQRDGIDVKTNFRVVKV
SDKAITMTNPSTGEISVPYGMAVWSTGIGTRPIILDLMKEIGQAGRRVLATDEWLRVLGS
DDVYALGDCATINQRKVLEDVSSIFQKADKNNSGKLTVRELKVVLDDIIERYPQLKLYLK
SKQMKDILDLLKDSDFNPEGESVELDIERFKRALANVDSQVKMLPPTAQVAAQQGTYLAK
CLNKMKQCEENPEGPPRIRGQGRHRFRPFRYRHLGQFAPLGGEQTAAQLPGDWISIGHSS
QWLWYSVYASKQVSWRTRFLVVSDWMRRFVFGRDSSRM
NT seq 1737 nt NT seq  +upstreamnt  +downstreamnt
atgcgggtcggtgctttcttcttcgatcgggcttcgaaagctctaaagaatccgacgttc
acgaagctcgtcgtcgttttcaccgtcagtggcggaggactagtggcatatgctgattcc
aagtcagacattggttctgaattatctcaagcatctaacaggaagaaagttgtagttctt
ggaactggttgggcagggaccagttttttgaaaactctagatagttccttgtatgatgta
caagtgatatcacctcgtaactattttgcatttacccctttgttaccaagtgtcacatgt
ggaacggtggaaccacgtagtattgctgaaccaatccgtaatatcataaaaaagaaaaag
gcagacatcaaattctgggaagctgaatgttttaagatcgacccaaagagcaagaaggtt
cattgtcgatctaatatagggacaaacttagatggcactggcgaatttgcagtagattat
gactacttggttattgctattggagctaggccaaatacattcaacacgcctggtgtgact
gagaactgccatttcctaaaggaaatagaggatgctcaaagaattcggaaaagtgtgatg
aactgctttgagaaggcagctctacctaatcttagtgaagaagagaggagaaaaactcta
cattttattgtgattggtggaggtccgactggggtagagtttgcagcagaactccatgat
ttcgtttctgaagatttggctaagctgtatcctaacattcgagatctagtgaaaatatca
ttgattgaagctggtgatcatatcttgacgatgtttgacaagaggattactcaatttgct
gaagagaaatttcaaagggatggcattgatgtgaaaacaaatttccgagtcgtcaaggtt
tctgataaggccatcacgatgacaaatccatcaacaggagaaatttctgtgccttacggg
atggcagtctggtccactggcattggtactcgcccaatcatattggaccttatgaaagaa
attggccaggctggtcggcgtgtgttggcaactgacgagtggcttagagtacttggaagt
gatgatgtgtatgcacttggggattgtgccactataaaccagcggaaggtcttggaagat
gtatcgtcaatttttcagaaagcagacaaaaacaattcgggaaaattgaccgttagagaa
ctcaaagttgttttagatgatataatcgaaagataccctcagttgaaactctatctcaaa
agcaagcaaatgaaagatattttggatctcttgaaggattctgattttaatcctgaaggt
gaatctgttgaactggacatagagcgttttaagagagcccttgcaaatgtggattcacaa
gtcaagatgcttcctccaacagctcaggttgcggcacaacaaggaacttatcttgccaaa
tgcttaaacaaaatgaagcaatgtgaagaaaatcctgaaggtcctcctcgtattagagga
cagggacgtcatcgatttcgccccttcaggtataggcatttaggccaatttgctccgctt
ggtggggagcaaacagctgcacaactgccaggagattggatttctataggccatagcagt
caatggctctggtattctgtatacgcaagcaagcaagtcagttggcgcacaagattcctc
gtggtatctgattggatgagaagattcgtctttgggagggactcgagtcgcatgtga

DBGET integrated database retrieval system