KEGG   Asparagus officinalis (garden asparagus): 109834756Help
Entry
109834756         CDS       T05243                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: thiamine thiazole synthase 1, chloroplastic-like
  KO
K03146  cysteine-dependent adenosine diphosphate thiazole synthase [EC:2.4.2.60]
Organism
aof  Asparagus officinalis (garden asparagus)
Pathway
aof00730  Thiamine metabolism
aof01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aof00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    109834756
Enzymes [BR:aof01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.60  cysteine-dependent adenosine diphosphate thiazole synthase
     109834756
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Thi4 NAD_binding_8 RNA_pol_Rpb1_3
Motif
Other DBs
NCBI-GeneID: 109834756
NCBI-ProteinID: XP_020258366
Position
3
AA seq 437 aa AA seqDB search
MHQLTPSKFAELEPNAKQRHSHTFSIQPPRVLDISAPSPPTNTPPPLTALVLTLKKTPQT
SLPPKKASRALPRPTSNLVQKWPSKPPWHLLPPLQPQQTAASSPPPPFHGVKLSSGLQNP
NLSLPRHHHLSSPCLPKSRLLRPLILSASAPIKESIVXREMTRRYMTDMITYATRTSSSS
APGSAALSCAYELSKNPDINIAIIEQSVSPGGGAWLGGQLFSAMVVRXPAHLFLDELEVP
YDEQDDYVVIKHAALFTSTIMSKLLMRPNVKLFNAVAAEDLIIKDGRVGGVVTNWALVSM
NHDTQSCMDPNVMEAKVVVSSCGHDGPFGATGVKRLRSVGMIDTVPGMKALDMNAAEDEI
VRMTREVVPGMIVTGMEVAEIDGSPRMGPTFGAMMISGQKAAHLALKALGKPNSLEGAVH
PEMVLASNDGGDVVVDA
NT seq 1314 nt NT seq  +upstreamnt  +downstreamnt
atgcatcagcttaccccatcgaaatttgcagaactggagcccaacgcgaaacaaagacac
agccacacattctctatccaacctccacgtgtcctcgatatttccgccccctcaccccct
acaaatacccctcctcccctcactgccctcgtcctcactctcaaaaaaaccccccaaacc
tcccttcccccaaaaaaggccagcagagccctcccccgtcccacttccaaccttgtccaa
aaatggcccagcaagcctccatggcacctcctccctcctctccaaccccagcaaaccgca
gcctcctctcctcctcctcctttccatggcgtcaagctctcctccggccttcaaaaccca
aatctctctctcccccgtcatcatcatctatcatcaccctgtctcccaaaatctcgcctc
ctacgacctctcatcctctccgcttccgcccccatcaaggaatccatcgtcntccgcgag
atgacccgccgctacatgaccgacatgatcacctacgcgacccggacctcgtcgtcgtcg
gcgccgggatccgccgcgctctcctgcgcctacgagctctccaagaaccctgacatcaac
atcgccatcatcgagcagtctgtctcccccggcggcggcgcctggctcggcggccagctc
ttctctgctatggtcgtccgctagcccgcccacctcttcctcgacgagctcgaggtcccc
tacgacgagcaggacgattacgtcgtcatcaagcacgccgccctcttcacctccaccatc
atgagcaagctcctgatgcggcccaacgtgaagctgttcaacgcggtggcggcggaggat
ttgataatcaaggacgggagggtcgggggagtcgtgacgaactgggcgctggtgtcgatg
aaccacgatacacagtcgtgcatggacccgaacgtgatggaggctaaggttgtggtgagc
tcttgtgggcatgatgggccttttggggctactggggttaagaggctgaggagcgtcggg
atgattgacaccgtgcccgggatgaaggcgcttgacatgaacgcggccgaggacgagatc
gtgaggatgacgagggaggtcgtgcccgggatgatcgttaccgggatggaggttgctgag
atcgacggatctccgagaatggggccgacgttcggagcgatgatgatatcggggcagaag
gcggcgcacctggcgctgaaggcgctgggaaagccgaactcgttggaaggagctgtgcat
cccgagatggttttggcttcgaacgatggcggagatgttgttgttgatgcttag

DBGET integrated database retrieval system