KEGG   Asparagus officinalis (garden asparagus): 109836384Help
Entry
109836384         CDS       T05243                                 

Definition
(RefSeq) non-lysosomal glucosylceramidase
  KO
K17108  non-lysosomal glucosylceramidase [EC:3.2.1.45]
Organism
aof  Asparagus officinalis (garden asparagus)
Pathway
aof00511  Other glycan degradation
aof00600  Sphingolipid metabolism
aof01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aof00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    109836384
  09107 Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    109836384
Enzymes [BR:aof01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     109836384
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DUF608 Glyco_hydr_116N Bac_rhamnosid6H
Motif
Other DBs
NCBI-GeneID: 109836384
NCBI-ProteinID: XP_020259862
Position
4
AA seq 972 aa AA seqDB search
MVSGHLFHCRKHSWPADEYVNRTTLQLLDFDGGAPPRQAWRRRLNSHANKLKEFSVTFME
AMRMLSLGLRLWSYVREEASYGRKAPIDPFTRESCKPSASLGVPLGGMGSGSISRGFRGE
FKHWQILPGQCEMSPVMTNQFSIFITRDGGSKKFSSVLAPGHHEGIKKSGDKGISSWDWN
LSGQHSTYHALFPRAWTVYDGEPDPELKISCRQISPFIPHNYQESSYPTSVFVYTLVNTG
RERAKVSLLMTWANSIGGVSHLSGDHVNEPFIGEDGVSGVLLHHKTAKDNPPVTFAIAAC
ETQNVNVTVLPSFWLSGDDRVTASDTWAAMVQDGHFGRESFNSGPSRPSSPGDTLCAAVS
ASTWVEPHGRCTVAFALAWSSPKVKFQKGCIYHRRYTRFFGTSERSAVDLVHDALTKYKC
WEEEIEKWQNPILMDEKLPEWYKFTLFNELYFLVAGGTVWTDGEAPAFDERLKFSKKKDK
SMKISKPKSTKHNKAALVGHTATVSVTRNEDANVIGSLEGAAGHELSDCEKESGPEIVQG
GSHPNAHLDAENVGRFLYLEGVEYIMWCTYDVHFYASFALLDLFPKIELSIQRDFARAVL
AEDTRKIKFLADGNWGIRKVRGAVPHDLGTHDPWHEMNAYNIHDTSKWKDLNPKFVLQVY
RDFAATGDMAFGREVWPAVRAAVDYMEQFDRDEDGLIENDGFPDQTYDAWTVHGISAYCG
CLWLASLQAAAAMAHRLGDHAFAEKCTIKFMQAKQVIESKLWNGSYFNYDSGTSSNSRSI
QADQLAGQWYAASSGLPSLFDDSKIKSALQKIFDFNVMRVGGGRMGAVNGMHPNGKVDES
CMQSREIWTGVTYAVAANMLLAGMEQQAFTTAEGIFTTGWSEEGFGYWFQTPEAWTTDGH
YRSLIYMRPLSIWAMQWALSPPKAIIDAPKVNVMERIYISPLTIRALNENTGVKKIPPKA
GCFSSAVCHCDC
NT seq 2919 nt NT seq  +upstreamnt  +downstreamnt
atggtgagcggtcatctgtttcattgcaggaagcactcttggcctgctgatgagtatgtc
aacagaactactcttcaattgttggactttgatggtggtgcaccaccacggcaggcatgg
agaaggagattgaacagccatgctaataaattaaaggaatttagtgtgacatttatggaa
gctatgagaatgcttagtcttggtcttcgtctttggtcatatgttcgagaagaagcctct
tatggaaggaaagcaccaattgatccatttacccgagaaagttgtaagccctcagcttct
cttggggtcccacttggaggaatgggaagcggaagcatatctagaggtttcagaggggag
tttaaacactggcagattcttcctggacaatgtgaaatgtctccagtcatgacgaatcag
ttctctattttcattactcgagatggaggaagcaaaaaattctcttcagttttagcccct
ggtcatcacgaaggaataaagaaatctggtgataaaggaatatcatcttgggactggaac
ctgagcggtcagcattccacatatcatgctttatttcccagggcgtggactgtatatgat
ggtgaaccagacccagaactcaaaatatcatgtcgacaaatatctccattcatacctcac
aactatcaggagagcagctaccctacgtctgtgtttgtgtacactttagtgaacactggg
agagagagagcaaaggtcagcttgctcatgacttgggcgaattctattggcggagtttct
catctgtctggagatcacgtcaatgagccattcattggagaagatggagtatctggggtg
cttctacatcacaagactgctaaggataatcctccagttactttcgctattgctgcatgc
gaaactcaaaatgtgaacgtaacagtgttaccgagtttttggctttcaggggatgatcgt
gttacagctagcgacacgtgggctgctatggtgcaggatggacattttgggcgagagagt
ttcaattctggccccagtagaccatcctcgccaggagatactctttgtgcagcagtctca
gcctctacttgggtggagcctcacggaaggtgtactgttgcatttgctttagcctggtca
tcccctaaagtaaaatttcagaagggatgcatttatcacaggagatatacgagattcttt
ggaacttctgagagatcagctgttgatttggtgcatgatgcattgacaaagtataagtgc
tgggaagaagagattgagaaatggcaaaatcctattctcatggatgaaaagcttccagaa
tggtacaagtttactctttttaatgagctctactttttagttgctggaggaacagtctgg
acagatggtgaagctcctgcttttgacgagaggctaaaattttctaaaaaaaaagacaaa
tctatgaagatttcaaagcctaaatccacgaaacataacaaggcagctttggttgggcac
actgccactgtttctgtgacgcgcaatgaagatgcaaatgttattggttcattggaagga
gctgcgggacacgaactgtcagactgtgagaaggaaagtggtcctgaaattgtacagggt
ggatctcatccaaatgcccatcttgatgctgaaaatgttgggaggttcttgtacttagaa
ggagtagagtatatcatgtggtgtacttatgatgtacacttctatgcatcttttgctctt
cttgatctcttcccaaaaattgagctaagcatccagcgtgattttgctagggctgtctta
gccgaggatacaaggaaaataaagttcttggcagatggtaattgggggatccgtaaagtt
agaggtgctgttcctcatgatctaggaactcatgatccttggcatgaaatgaatgcgtat
aatatacatgacacgagtaaatggaaggatctcaacccaaagtttgtgcttcaggtgtat
agggattttgcggcaactggtgacatggcttttgggagggaagtctggccagcagttcgt
gctgccgttgactacatggagcagtttgatcgcgacgaagatggtcttattgagaatgat
ggctttccagatcaaacctatgatgcttggacagtgcatggcatcagtgcctattgtgga
tgcttgtggcttgcttcgctgcaagctgcagcggcaatggctcatcgtcttggagatcat
gcctttgcagagaaatgcactattaagtttatgcaagctaagcaggtgatagaatccaaa
ctatggaatggttcatacttcaattatgacagcgggacaagtagcaacagtcgctctatt
caggcagatcaactggcagggcaatggtatgctgcttcttcggggttgccctcacttttt
gatgatagtaaaatcaaaagcgcacttcagaaaatatttgactttaatgtgatgagggtt
ggaggagggcgtatgggagcagttaatggaatgcatcctaatggaaaagttgacgaatct
tgcatgcagtcacgtgaaatctggactggtgtgacttatgctgtagctgccaacatgctt
cttgctggtatggagcagcaggcgtttactactgcagaaggtatttttactacaggctgg
tcagaagaaggatttgggtactggtttcagacccctgaagcatggacaacagatggacat
taccgatcattaatctatatgcgccctctctcaatctgggcaatgcaatgggcactgtct
ccaccaaaggcaattatcgacgccccaaaagttaacgttatggagaggatctacatttcc
ccgctcacaattagggctctcaacgagaacacgggagtgaagaagattccccctaaagcc
ggttgtttcagcagtgcggtctgtcactgtgactgctaa

DBGET integrated database retrieval system