KEGG   Asparagus officinalis (garden asparagus): 109837263Help
Entry
109837263         CDS       T05243                                 

Definition
(RefSeq) tripeptidyl-peptidase 2
  KO
K01280  tripeptidyl-peptidase II [EC:3.4.14.10]
Organism
aof  Asparagus officinalis (garden asparagus)
Brite
KEGG Orthology (KO) [BR:aof00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:aof01002]
    109837263
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:aof03110]
    109837263
Enzymes [BR:aof01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.14  Dipeptidyl-peptidases and tripeptidyl-peptidases
    3.4.14.10  tripeptidyl-peptidase II
     109837263
Peptidases and inhibitors [BR:aof01002]
 Serine peptidases
  Family S8: subtilisin family
   109837263
Chaperones and folding catalysts [BR:aof03110]
 Intramolecular chaperones
  Subtilisin family
   109837263
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_S8 TPPII CcdA
Motif
Other DBs
NCBI-GeneID: 109837263
NCBI-ProteinID: XP_020261018
Position
4
AA seq 1357 aa AA seqDB search
MHNAIGVHCGLLSSLPNFLSLSPLSFSRIGTFRNKRASAAEGNIAVIARVSMPSSSPHTS
APLSEETPKIDEALRSGRLNEKSFLASLMPKKEINADKFLESHPEYDGRGVLIAIFDSGV
DPAAAGLQVTSDGKPKIIDILDCTGSGDIDTSKVVKADADGYIIGGSGAKLLVNQSWKNP
SQEWHVGYKLVYELFTDTLTSRIQKERKKKWDEKNQEAIVEALKNLNEFDKKYAKTEDSK
LKRVREDLQSRLDFLKKQAESYDDRGPIIDLVVWNDGDVWRVAVDTQSFEDDSEHGKLAD
FVPLTNYRTERKFGIFSKLDACSFITNVYDEGNLVSLVTDCSPHGTHVAGIATAFHPEEP
LLNGVAPGAQLISCKIGDTHLGSMETGVGLTRALIAAIEHKCDLINMSYGEPTLLPDYGR
FVDLVNEAVDKHRVIFISSAGNEGPGLSTVGSPGGTTSSIIGIGAYVSPAMAAGAHCVVE
PPNEGMEYTWSSRGPTVDGDLGVCISAPGGAVAPVPAWTLQRRMLMNGTSMSSPSACGGV
ALLVSGMKAEGIPVSPYIVRKALENTALPIGSVPEDKLTTGQGLMQVDRAHQFVQKSRDL
PCVCYKISINQTGKTTPTLRGIYLRGASACQQNTEWTIQVNPGFHDGASNLEQLVPFEEC
IQLHSSEKSVAQAPEYLLLTNNGRSFNIVVDPTHLSSGLHYHEVHGIDFKAPWRGPLFRV
PITILKPTIPTGQPPQILFSRISFTPGLIERRFIEVPHGATWVEATMRTSGFDTARRFFI
DAVQISPLTRPIKWEAVVTFSSPSFKTFMFAVKGGLTIELAIAQFWSSGIGSNEAATVDF
EMVFHGISINGGTLLFDGSEAPVKIDAKSLLAAEKLVPSATLNKIKVPYRPVESNLSTLP
TSRDKLPSGKQIIALTLTYKFKLEEGAEIKPHIPLLNNRVYDTKFESQFYSISDINKRVY
ACGDVYPKYVKVPRGEYTLQLYIRHENVHFLEKMRQLVLFIERKLEKKDFVQLSFFSQPD
GCIMGNGTFKSSVLLPGDSEAFYVGPPSKENLPKNCQPGSVLVGSLSYGAVSLSGSKDNN
HSQSPPVSHKISYLIPPCKMDEDRGKASSICSKSIVERLQEEVRDAKIRILSSLKRNSEE
ERKAWNAFSASLKEEFPNYTPLLTKILEGLIAGGSDEDNVHHNQEIIKAANEVIESIDKA
ELAEWISKKPDPEDEEAETIQKKKETARDQLAEALYRKGLALAEIGSKVEQAPAEESKEM
LSEQSDQFEENFKEIKKWVDIKSPKYGMLLVVRERRNGRLGMALKALNDLIQDESEPPKK
KFYDLRIELLDEIGWSHVACYEKLWMHVRFPSSLPLF
NT seq 4074 nt NT seq  +upstreamnt  +downstreamnt
atgcataacgccatcggtgtgcattgcggcctgctatcatcattacccaattttctctct
ctctctcctctgtcattttctcgaatcggcacttttagaaataaaagagcatcagcagct
gagggcaacatcgccgtgatcgctagggtttcgatgccttcatcttctcctcacacatct
gctcctctctccgaagagacgccgaagatcgacgaagctctacgctcgggtcgattgaac
gagaagagtttcttagcttctttgatgccgaagaaggaaatcaatgccgataagtttctt
gaatctcatcctgagtatgacggcagaggcgtccttattgctatttttgattctggcgtg
gatccagctgctgctggtctacaggtgacttcagatggcaaacccaaaatcatagacata
ctagattgcacaggaagtggtgatattgacacctccaaagtagtgaaggccgatgctgac
ggttatattattggcggatcaggggcaaaattgttggtaaatcagtcatggaaaaatcct
tctcaggagtggcatgttggctataaactagtgtatgaactctttactgacacactgaca
tcccgtatacagaaggaaaggaagaaaaagtgggatgagaaaaatcaggaagcaattgtg
gaagctctgaagaaccttaatgagtttgacaagaaatatgccaaaacagaagactcaaag
ttaaaaagggttcgtgaagacctccaaagtagacttgatttccttaaaaaacaagctgaa
agttatgatgataggggacctattatcgatctcgtcgtgtggaacgatggtgatgtgtgg
agagttgctgttgacacacaaagtttcgaggatgattcagagcatgggaaactggctgat
tttgttcctttaactaactacaggactgaacgaaaatttggcatttttagcaaattggat
gcttgctctttcattacaaatgtttatgatgaaggaaatcttgtaagtttagtaacagat
tgctctccacatggcactcatgttgcaggcatcgctactgctttccatcctgaggagccc
ttgctaaatggagttgcacctggagcccaattgatctcttgtaagattggagatacacac
ttaggttcaatggaaactggagttggtttgactagagctttaatagctgccattgagcac
aaatgtgacctcatcaacatgagttatggggagcccacactgttgcctgattatgggaga
tttgttgatctagtcaatgaagctgtagacaagcatcgtgtcatattcattagcagtgct
ggaaatgagggaccggggttaagtacggtgggttcccctggtggaactacttcgagcatt
ataggaattggtgcatatgtttcccctgctatggctgcaggagctcattgtgtggtggag
cctccgaatgaaggaatggaatatacttggtctagccggggtccaacagttgatggtgat
ctaggtgtgtgtataagtgctcctggtggagctgtggctcctgtacccgcgtggacttta
cagcgacgcatgctcatgaatggaacttccatgtcatctccatcagcttgtggtggagtt
gcgttacttgttagtggaatgaaggctgaaggtattccagtaagtccctatattgtacgg
aaggcgttggagaatacagcacttcccataggtagtgtgcctgaggataaattgacaaca
gggcaggggcttatgcaagttgacagggcacatcaatttgttcagaagtctagggatctt
ccatgtgtttgctataaaatttctataaatcaaactggaaaaacaactccaacactaaga
ggaatctatctaagaggagccagtgcttgtcaacagaacaccgagtggactattcaagtt
aatccagggttccacgacggtgcaagtaacttggaacaattggttccatttgaagaatgc
atacaattacattcaagtgaaaaatcggttgcacaagctcctgaatacctcctgctaact
aacaacgggcgtagtttcaacatagttgtggatcctactcatctcagcagtggcttgcac
tatcacgaagtacatggtatagatttcaaagctccatggcggggtcctttgttcagggtg
ccaattacaatcttgaagcctacaataccaactggccagccaccacaaattttattttct
aggatctcatttacgccgggtcttattgaaagaaggtttattgaggtgccacatggagct
acatgggttgaggcgacgatgcgaacttccggatttgatactgcacgaaggttcttcatt
gatgctgttcagattagtccattgacacggcctatcaagtgggaagctgttgtgacattt
tcatctccttcatttaaaactttcatgtttgctgtgaaaggtggtctgaccattgaattg
gctattgcccagttctggtccagtggtattggtagtaatgaagctgctactgttgatttt
gagatggtatttcatgggattagcatcaacgggggcacattgttgttcgatggaagcgag
gcacctgtcaaaattgatgcaaaatctttattggcagctgaaaaacttgtcccatcagct
actttaaacaagataaaagtgccttatcggcccgtagagtctaacctgagtactctacct
acatcccgtgataagttaccctctggcaagcagattattgctctaaccttaacttacaaa
ttcaaattggaagaaggagctgaaataaagccccatattcccctcctaaacaatcgggta
tatgataccaaatttgagtcacagttttacagcatatcagatattaataagcgtgtctat
gcatgtggggatgtctaccctaaatatgtgaaggtcccaaggggagaatacaccttgcaa
ctgtatataagacatgaaaatgttcattttctggagaaaatgaggcagctggttttgttt
attgaaaggaaattggagaaaaaggactttgtccaattgagttttttctctcagcctgat
ggttgcataatgggaaatggcacctttaagtcctcagttttactacctggtgattctgaa
gcattttacgtgggtccaccatcaaaggaaaatcttccaaagaactgtcagcctggatct
gttctggttggatctctttcctatggtgcagtatctctcagtggcagcaaagacaataac
cattcacaatcaccaccagtatctcataagatttcttatcttatcccaccttgcaagatg
gatgaggatagaggaaaggcaagctccatttgcagtaaaagtatagttgagcggctgcag
gaagaggtgagagatgctaaaataaggatactgtcgagcttaaagcgaaattcagaagaa
gaacgaaaggcatggaatgcattttctgcttctcttaaggaggagtttccaaactatacg
ccattgcttacgaaaattctagaaggcttaattgcaggaggttctgacgaagacaatgtc
catcataaccaagagattatcaaggcagccaatgaggtaattgagagtatagacaaagct
gagttagcagaatggatttcaaagaaacctgatcctgaagatgaagaagcagagactatt
caaaagaagaaggagacagctcgtgaccaattagcagaggctctatacagaaaggggcta
gcacttgcagaaattggctctaaggttgaacaggcgcctgcagaggaatctaaggaaatg
ctgagtgaacaatcagatcagtttgaggagaacttcaaagaaataaagaaatgggttgat
attaaatctccaaaatacggcatgctgttggtggtgcgtgaaaggcgtaatggaagactt
ggaatggcgttgaaggcactaaatgatctgatccaagatgaatccgagccaccaaagaag
aagttctatgatttaagaattgaattgcttgatgagattggatggagccacgtggcatgt
tacgagaagctgtggatgcatgtgcgctttccttcgagtttgcccctattttag

DBGET integrated database retrieval system