KEGG   Asparagus officinalis (garden asparagus): 109839036Help
Entry
109839036         CDS       T05243                                 

Definition
(RefSeq) probable receptor-like protein kinase At5g24010
Organism
aof  Asparagus officinalis (garden asparagus)
Brite
Enzymes [BR:aof01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     109839036
Protein kinases [BR:aof01001]
 Serine/threonine kinases: TKL group
  IRAK family
   109839036
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase Malectin_like Ribosomal_S17e ABC1 CD34_antigen
Motif
Other DBs
NCBI-GeneID: 109839036
NCBI-ProteinID: XP_020263056
Position
4
AA seq 711 aa AA seqDB search
MSTPNQLTLDLVPYSLAFVNAIEVFNAPPYLVDGDGCHLRNCGRRRWSSRPAVANKGLES
LYRVNVGGSLVTPANDTLWRTWVTDDPYIFRSSVSFKNSTSASAIVYRSSDPRQTPEIAP
QSVYDTARTMAIMEDMENSGNQFNVTWSFNVTPGETHFIRMHFCDFVSAQVTALYFNVYI
GNLLAYADLQPSSFTDQTPAAAFYLDFAADSDESGLMNVSVGRSNRSTPQAANALLNGLE
IMKLGLDSTTTNTHTNGVSIKILIPPIVFGVILVPILILAAVFLHKRRRKPKSAVRPKAS
PSASSSPFAPDFAGASTSESNFNSTSPRVNLDLQIPFEEIKFATDNFSDSLVIGTGGFGK
VYKGVLRDGTKIAVKRGMPESKQGYPEFQTEIEVLSRIRHRHLVSLIGYCNDHSEMILVY
EYMEKGPLKNYLYGSNNLPSLTWKQRLEICIGAARGLHYLHTGYSHNIIHRDIKSTNILL
GGDYLAKVADFGLSRVGPSFGETHVSTGVKGTFGYLDPEYYKVQKLTDKSDVYSFGVMMF
EVLCARPVIDPKLSREQLNLAEWAVLSQRRGRLEKIIDPKLVGEINENSLRKFGQTAEKC
LANYGVDRPTIGDVLWNLEYALQLQMTELRREPFEDSGVVEAREEERERRIDFVPDVSEI
KVERIEVDKETMEMLSSIGMGDFLGVEKHAEVIVKAPAYGGSGGFANGHRS
NT seq 2136 nt NT seq  +upstreamnt  +downstreamnt
atgtcgactccgaatcaactcacgctcgacctcgtgccgtattcactagccttcgtcaac
gcgatcgaggtcttcaacgcccctccctatctcgtcgacggcgatggctgccacttacgt
aactgcggcaggcgacgctggtcctctcggccagctgtcgcgaacaaaggactggagagt
ctctacagggtcaacgtcggcgggagtttagttaccccggctaacgacactctgtggagg
acttgggtcaccgacgatccatacatctttcgtagttcagtctcattcaagaacagcacg
agcgcgtcggcgatcgtgtacaggtcgtcggaccccagacagacgcctgagatcgcgcca
cagagcgtctacgacacggcccgaactatggccatcatggaggatatggagaattccggt
aaccaatttaatgtcacgtggagttttaacgtaactccgggcgagacgcacttcatcagg
atgcatttctgcgatttcgtgtctgctcaggtgactgcgctctactttaatgtgtacatc
gggaacttgttagcttatgctgatctgcaaccgagctcgttcactgatcagacgcctgct
gcggctttctatttggatttcgccgcggattcagacgagtctggtctgatgaatgtgagc
gtcggtagatcgaataggagcacgccgcaggccgctaatgcgttgctgaacgggttagag
ataatgaaacttgggctcgattcgacgactacaaacacacacacaaatggggtctcgatc
aaaattctcattcctccaatcgtctttggggttattcttgttccgatattgatactggct
gcggtctttttacataaaaggcgtcggaagccgaagagtgctgtgcgacctaaggcctct
ccatcagcatcctcgtctcctttcgccccagatttcgctggcgctagtacaagtgaatcc
aatttcaacagcacgtcaccaagagtcaacctcgatctgcaaatccccttcgaagagatc
aagttcgcaactgataatttcagcgacagtctagtgattggtactggaggctttggcaaa
gtctataaaggtgtgctaagagacggcaccaaaatcgctgtgaagcgaggaatgccagaa
tcaaaacaaggctaccctgaattccaaaccgaaatcgaagttttatcacgaatccgccac
cgtcatcttgtatccctcatcggatactgcaacgatcattcggagatgattcttgtctat
gagtacatggaaaagggacctctgaagaattacttatacgggtccaataatttaccgagc
ctgacatggaagcagaggctcgagatttgcataggcgcagcgagaggtctgcactacttg
cacactggatactctcacaacatcatccatcgcgacatcaaatccaccaacattctattg
ggtggcgactacttagccaaagttgcggatttcgggctctcaagggtcggtccctctttt
ggggagacccacgtaagcaccggagtcaaaggaacgttcgggtacttagatccggagtac
tacaaagttcagaaactcactgacaagtccgatgtgtactcattcggtgtgatgatgttt
gaggttctatgcgcaaggccggtgatcgatcccaaactgtccagagagcagctgaatttg
gcggagtgggcagtgttatcccagaggagaggtagactagagaagattatcgacccgaag
cttgtcggagagatcaatgagaactcgttgaggaagttcgggcagactgcggagaagtgt
cttgctaattatggggtcgataggccgacgattggggacgttttgtggaatcttgagtat
gcgctgcagttgcagatgacggagctgaggcgagagccgtttgaggatagcggggtcgtg
gaggcgcgggaggaggagcgcgagcgaaggatagacttcgtccctgacgtgtcggagatc
aaggttgagcggatcgaggtcgacaaggagacaatggagatgctctcgagtatcgggatg
ggggattttcttggagttgagaagcatgctgaggtcatcgtcaaggcaccggcctatgga
ggaagtggtgggttcgccaacggtcacaggagctaa

DBGET integrated database retrieval system