KEGG   Asparagus officinalis (garden asparagus): 109840244Help
Entry
109840244         CDS       T05243                                 

Definition
(RefSeq) calcium/calmodulin-regulated receptor-like kinase 2 isoform X1
  KO
K04733  interleukin-1 receptor-associated kinase 4 [EC:2.7.11.1]
Organism
aof  Asparagus officinalis (garden asparagus)
Brite
KEGG Orthology (KO) [BR:aof00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:aof01001]
    109840244
Enzymes [BR:aof01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     109840244
Protein kinases [BR:aof01001]
 Serine/threonine kinases: TKL group
  IRAK family
   109840244
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase PIP49_C THOC7
Motif
Other DBs
NCBI-GeneID: 109840244
NCBI-ProteinID: XP_020264402
Position
5
AA seq 431 aa AA seqDB search
MANQTNIIIIGVSVGVAVGILVASCAFIAIRFYRKRSHVQNRSVESASTLPIRVNGIDAS
IDSSASIAVSEIGHGLHDIGKKNHYWGRRGNPSKDLLHSLSGIPRYVYKDIQKATQNFTT
ILGEGSFGPVYKAIMPTSAVVAVKVLANNSKQGEKEFQTEVLLLSRLHHRNLVNLVGYCV
DKGQHMLIYEFMSNGSLASLLYDVGDNTRNLSWEQRLQIALDVSHGIEYLHDGAVPPVVH
RDLKSANILLDKSMRAKVADFGLSKEEVYDGRNSGLKGTYGYMDPDYMSTNNYTKKSDIY
SFGIILFELLTSINPQQGLMDYINLAAIGGEGKADWDEIIDSKLSCMSNIEEIRQLADIA
HRCLHKIPRKRPSIADVTHAISRIGRRRLNRDETLSIAGSINALGFLKRLERQQVELSHL
TSIKESPAAVV
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
atggcaaatcaaactaacataatcattattggggtctctgtcggtgttgcggttggaatc
ttggtggcatcttgcgcatttattgctataaggttttatagaaagcggtctcatgtccaa
aatcgttcagttgagagtgcatctactcttcccattcgtgtaaatgggatcgatgcaagt
attgattctagtgcttcgatcgcagtttctgagattgggcatggtttacatgatattggg
aagaaaaaccactattggggtcgaagaggaaatccaagcaaagatctacttcattcctta
tcaggcattccaagatatgtgtacaaggacattcagaaagctacacagaattttacaact
attttaggagaaggatctttcggtccagtctacaaagctataatgcctacaagtgcagta
gtagctgtaaaggtgcttgcaaataattccaagcaaggggagaaagaattccaaacagag
gttttgttgcttagtagactgcaccataggaatcttgtgaatttggttggatactgtgtg
gataaaggccagcacatgctcatctatgagttcatgagcaatggaagtctggctagccta
ttgtatgatgtaggcgataatacccgaaacttaagctgggaacaaaggctgcaaattgca
cttgatgtttcacatggaattgaatacctacacgatggggcagttccacccgttgttcac
cgggatctaaaatctgccaatattcttcttgacaagtcaatgagggctaaggtagctgat
tttgggctttccaaagaagaggtttatgatggaagaaactcgggtcttaagggaacgtat
ggctacatggatcctgactacatgtcaacaaacaattacacaaagaagagcgacatatat
agctttggcataatattatttgaacttctaacatccataaatcctcagcaaggtctgatg
gattacatcaatctcgcggcaattggaggagagggaaaggccgattgggatgagataatc
gatagcaagctatcatgcatgagcaatatcgaagagatcaggcaattagctgatatagct
cacagatgcttacacaagattccgaggaaacgcccttcaatagctgacgttactcatgct
atatcgagaataggaagaagacgtctaaatagggatgaaaccctgtcaatagctggaagc
atcaatgcgttagggtttttgaaaaggctagaacgtcagcaagtcgagcttagccacttg
accagcatcaaggagtccccagctgctgtcgtttga

DBGET integrated database retrieval system