KEGG   Asparagus officinalis (garden asparagus): 109840482Help
Entry
109840482         CDS       T05243                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: DNA-dependent metalloprotease WSS1-like
  KO
K22685  DNA-dependent metalloprotease WSS1 [EC:3.4.24.-]
Organism
aof  Asparagus officinalis (garden asparagus)
Brite
KEGG Orthology (KO) [BR:aof00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:aof01002]
    109840482
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:aof03400]
    109840482
Enzymes [BR:aof01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.-  
     109840482
Peptidases and inhibitors [BR:aof01002]
 Metallo peptidases
  Family M80
   109840482
DNA repair and recombination proteins [BR:aof03400]
 Eukaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    Other HR factors
     109840482
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: WLM DUF45
Motif
Other DBs
NCBI-GeneID: 109840482
NCBI-ProteinID: XP_020264740
Position
5
AA seq 300 aa AA seqDB search
MNLQDLHKVWEIKALKKPGLILDRIAKQVQPIMRRREWRVKLLSEFCPSNPALLGLNVGG
GVEVKLRLRRPKRDWDFFPFEQVLDTMLHELCHIQHGPHNAQFYKLWDELRVECEELVSK
GITGTGQGFDARGQRLGGFTRQPPLSSLRXNAAAAAVKRARNGALLPSGPRRLGGDSEIM
TALSPIQAAAMAAERRMQDDLWCGSGWHESFSAPESELGKFEHSTSVGCGESSKSGNVSR
GPCNDDKDQSGLIVGSVNTSALGNRAGGISISSGSSSCGSIGDAENKVIWECSICTMHFV
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
atgaatctccaagacctgcacaaggtttgggagatcaaagccctaaagaagcccggcctc
atcctcgatcggatcgccaagcaggtgcagcccattatgcggcggcgggaatggagggtc
aagcttctctcagagttctgtccgtccaatccggcgcttttagggttgaatgtgggaggt
ggagtcgaggttaagcttaggctgcggaggccgaagagggattgggatttcttcccattt
gaacaagtccttgatacgatgcttcatgaattgtgtcatattcagcatggacctcataat
gctcagttttacaagctctgggatgaactccgagtggaatgtgaggaattggtatcaaag
ggtataactggcaccggacaggggtttgatgcccgaggacaacgattgggtgggtttact
cgacagcctccattgtcgtctcttcggnncaatgcagcagcagcagcggttaaacgtgca
cgtaatggcgccctattaccttctggacctagaagattaggcggggatagtgaaattatg
actgcactgtctccaatacaagctgctgcaatggctgcagagaggagaatgcaagatgat
ttgtggtgtggctctgggtggcacgaaagtttcagtgcaccagagagtgaacttggaaag
ttcgagcattctacatcagtaggttgtggggaatcttcaaaaagtggtaatgtttccagg
ggtccttgtaatgatgataaagatcagagtggtttaattgttggttctgtgaatacatcc
gcgcttggtaacagagctggtggaatatcaatatctagtggttcatcttcctgtgggagc
ataggtgatgctgaaaataaagtgatctgggaatgcagtatatgcactatgcactttgtt
taa

DBGET integrated database retrieval system