KEGG   Asparagus officinalis (garden asparagus): 109841200Help
Entry
109841200         CDS       T05243                                 

Definition
(RefSeq) probable receptor-like protein kinase At1g80640
Organism
aof  Asparagus officinalis (garden asparagus)
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Pkinase_fungal APH CcmD
Motif
Other DBs
NCBI-GeneID: 109841200
NCBI-ProteinID: XP_020265697
Position
5
AA seq 393 aa AA seqDB search
MQILVIYEHHHLEKQLVLAIVLSSVAVALIFLSIFVVWIFWRRNQNDPEKKTAQGSDTSR
GITLGPILSKFSSFNTAGRKPSLAMVEYSLLESATNNFSESNILGEGGFGFVYKACFDGG
FLAAVKKLNGGRQDCEREFENEVNLLGKIQHPNIISLLGYCLHGEMRFLVYELMHNGSLE
TQLHGPSHGSALTWHIRMKIALDAARGLEYLHEHCNPPVIHRDLKSSNILLDSEFNAKIS
DFGLAVTGGNENKGNIKLSGTLGYVAPEYLLDGKLTEKSDVYAFGVVLLELLMGRKPVEK
LAPSQCRTIVTWAMPQLTDRSKLPNIVDPAIKNTMDLKHLYQVAAVAVLCVQPEPSYRPL
ITDVLHSLIPLVPVELGGTLRVSDPSRSPKVEF
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgcagatattagtgatttatgaacaccaccatttggaaaagcaattagttctggcaatt
gtcctatcttcagttgcggtagctctgatctttctatcgatttttgtggtctggatcttt
tggcgaaggaatcaaaatgaccccgagaaaaagactgctcaaggctcggatacaagtaga
ggaatcacgttaggcccaatcttgagcaagttcagttctttcaatacggcaggcagaaaa
ccttcacttgccatggtggagtattcgctgttagaatccgcaaccaataatttcagtgag
agtaatatccttggagaagggggctttgggtttgtttataaagcttgcttcgatgggggt
tttcttgctgcagtaaagaagctaaatggtggtaggcaagattgtgaaagagagttcgag
aatgaggtaaatttgctggggaaaattcaacatccaaatataatttctttgttgggttat
tgccttcatggagaaatgagattcctcgtatatgagttgatgcataatggatctttggaa
acacaattacatggaccatctcatgggtcagctttaacttggcacattcggatgaaaatc
gcactagatgcagcaagaggattagagtatctacatgagcattgcaacccacctgtgatc
catagagatctgaaatcatccaatattcttttggattcagaatttaatgccaagatttca
gattttggccttgcagtgactggtggtaacgaaaataaaggcaatatcaagctttcaggc
actcttggttatgtagctccagagtatcttctagatggtaaactcacagagaaaagtgat
gtttatgcctttggagtagttcttctcgagcttctcatgggaagaaaaccagtcgagaaa
ctggccccatctcagtgccgaactatagttacatgggccatgcctcagctaacagatcga
tcaaagctaccaaacattgtggatccagcaattaaaaacacaatggatttgaaacattta
taccaagtggcagctgttgctgtgctttgtgttcaacctgaacccagttatcgccctctg
ataactgatgtccttcactctttaattccgttagtacctgtagagctcgggggtacactt
agagtttctgacccatccaggagtccaaaagttgagttctga

DBGET integrated database retrieval system