KEGG   Asparagus officinalis (garden asparagus): 109841283Help
Entry
109841283         CDS       T05243                                 

Definition
(RefSeq) LEAF RUST 10 DISEASE-RESISTANCE LOCUS RECEPTOR-LIKE PROTEIN KINASE-like 2.5
Organism
aof  Asparagus officinalis (garden asparagus)
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr YukC APH ABC1
Motif
Other DBs
NCBI-GeneID: 109841283
NCBI-ProteinID: XP_020265799
Position
1
AA seq 393 aa AA seqDB search
MIDQHSVSGTKLLTVYFSSLFSGISIGTASFLIGSLLFILLFRRQKISYGLFSWKKKAKH
AQTIEAFLKKYHSLATKRYTYSDIKKITKSFSEKLGQGGYGSVYKGKLFDGNLVAVKVLD
ETKSNGEDFINEVAAIGNTSHINIVTLRGFCVDGPKRALIYDFMPNGSLEKYICSMKNPT
GEASIGWEKLYEIVVGIARGLEYLHRGCNNRIVHFDIKPHNILLDEDFCPKIADFGMSKL
CPPKQSIVSMYGFRGTPGYIAPEVWSRSFGVVSSKSDVYSYGMMILHIFEGKNSTNTRFE
SNSEAYFPQSIYQHIDNGDYLQEIGVTNETEEIARKMMIVGFWCIQTMPDDRPTMTRVVD
MLEGDTDELSIPQKPVLASPLDSIPGPCIASSA
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgatagatcagcatagtgtatcgggtactaaacttttgactgtttatttctcctctctt
ttctcaggtatatctattggaacagcaagctttctcataggaagcttgctttttattctt
ttgtttcgccggcagaaaatatcttatggactattttcttggaagaagaaagcaaagcat
gcccaaacaattgaagcctttctgaaaaaataccattctctagctacaaaacgttataca
tactctgatataaagaaaataaccaagtcatttagtgaaaaactaggtcaaggtggttat
ggcagtgtttacaagggtaaattgtttgatggcaatctagtggctgtgaaggtcttggat
gaaactaaaagtaacggcgaggacttcatcaatgaggtagctgccattggaaatacttct
catataaatattgtcactctaagaggattttgtgttgacgggccaaaacgagcactgatc
tatgatttcatgcccaatggttctttagagaagtacatatgctcaatgaagaatcctacg
ggagaagcttcaataggatgggaaaagttgtacgagatagtagttggtatagctcgaggg
ctagaatacttgcatcgaggatgtaacaatcgaattgttcattttgacatcaagcctcac
aatatcctactagacgaagatttctgcccaaagattgcagactttgggatgtccaaactg
tgccctccaaaacaaagtatagtatcaatgtatggatttagaggaaccccaggttacatt
gcacccgaagtatggtcgagaagttttggtgttgtctctagtaagtctgatgtttatagc
tacggcatgatgattcttcatatatttgaaggcaaaaatagcaccaatacaagattcgag
agcaatagtgaagcttactttcctcaatcgatttatcagcacatcgacaatggggattat
cttcaagaaatcggagtaacgaatgagactgaagaaatcgcaaggaagatgatgatcgtt
ggattttggtgcatacaaactatgccagacgaccgacccacaatgactagggtggttgat
atgctggaaggagacacggatgaattgtcaattccacagaagccagtcctagcatctcct
ttggattcgataccaggtccttgcattgcatcctccgcttga

DBGET integrated database retrieval system