KEGG   Asparagus officinalis (garden asparagus): 109841330Help
Entry
109841330         CDS       T05243                                 

Definition
(RefSeq) NADPH--cytochrome P450 reductase-like
  KO
K00327  NADPH-ferrihemoprotein reductase [EC:1.6.2.4]
Organism
aof  Asparagus officinalis (garden asparagus)
Brite
Enzymes [BR:aof01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.4  NADPH---hemoprotein reductase
     109841330
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_1 Flavodoxin_1 NAD_binding_1
Motif
Other DBs
NCBI-GeneID: 109841330
NCBI-ProteinID: XP_020265855
Position
5
AA seq 703 aa AA seqDB search
MQSETMKLSPLDLMTALLTGKLGDGGLPPEAAAIAENRELLMILTTAIAVLIGCAVVFLW
KRSSGKSSKSVEAPRPLVVKKEAEPEVDDGKKKVTIFFGTQTGTAEGFAKALAEEAKARY
DKAVFKVVDLDDYAADDDEYEEKMKKESLALFFMATYGDGEPTDNAARFYKWFTEGKERE
KWLDNLQYAVFGLGNKQYEHFNKVAKVVDEILDEQGAKRLVPVGLGDDDQCIEDDFTAWR
ELLWPELDQLLRDEDDASGASTTYRAAVPEYRVVVIDSAATSHLEKNWSLANGHAVHDIH
HPCRANVAVRKELHTPASDRSCIHLEFDIAGTGLRYETGDHVGVYSENSLETVEEAEKLL
GLPSDTFFSIHADNEDGTPLSGSTLPPPFPSPCTLRTALTRYADLLNSPKKAALVALAAH
ASDPNEAERLNFLASPAGKDEYSQWIVASQRSLLEVMAEFPSVKPPLGVFFAAIAPRLLP
RYYSISSSPRMAPTRIHVTCALVYGPTPTGRIHKGVCSTWMKHSIPMEISEECSWAPIFV
RQSNFKLPSDPSTPIIMIGPGTGLAPFRGFLQERLALKEDGAELGPAILFFGCRNRKMDF
IYEDELNNFVEAGALSELIVAFSREGPSKEYVQHKMMEKASELWNTISNGGYLYVCGDAK
GMARDVHRVLHTIAQEQGSLDSSKAEHMVKSLQMEGRYLRDVW
NT seq 2112 nt NT seq  +upstreamnt  +downstreamnt
atgcaatcggagacgatgaagctctcacctctagatctgatgacggcgcttttgaccgga
aagctcggcgacggtggactgccgcctgaggcggcggcgatcgcggagaaccgggagctt
ctgatgatcttgacgacggcgatcgcggttctgatcggatgcgctgtggtttttctgtgg
aagcgatcgagcgggaagtcgagcaagtcggtggaggctccgaggccgctcgtggtgaag
aaggaggcggagcctgaggttgacgatgggaagaagaaggttacgatctttttcgggacc
cagactgggactgctgagggttttgctaaggcgctggcggaagaggccaaggctagatac
gacaaggcggtgttcaaagtcgtcgatctggatgattatgcggctgatgacgacgagtac
gaggagaagatgaagaaggaaagtctagctctgttcttcatggcaacgtacggagatggg
gaaccgactgataatgctgctagattctacaaatggtttactgaggggaaagagagggaa
aagtggctggacaacctccagtatgctgtgtttggtctgggcaacaagcagtatgagcat
ttcaataaggtcgcaaaggtcgtagatgagatccttgatgaacagggagcaaaacgtctt
gtcccagtggggctcggggacgatgaccagtgcattgaggatgatttcactgcatggaga
gagctattatggccagaattagatcagctgcttcgagatgaagatgatgcatcaggtgca
tctacaacttacagagctgctgttcctgaataccgtgttgtggtcattgactctgcagcc
acatctcatttggagaagaactggagtcttgcaaatggtcatgctgttcatgatatccac
catccatgcagagctaatgtggctgtgcggaaagagcttcatactccagcttctgatcgt
tcctgcattcatctggagttcgacattgctgggactggtcttcgatatgaaacgggagac
catgttggtgtatattcggagaattcccttgagaccgtagaggaggctgaaaagctatta
ggccttccatcagacacattcttctctattcatgctgacaatgaagatggaactccgcta
agtggcagcactctgccacctcctttcccatctccatgcactttaagaactgcccttaca
cgatatgctgatcttttgaattctcctaaaaaggctgctttagttgctttagctgcacat
gcttctgatcccaacgaagcggaaagattaaattttttggcttctcctgctgggaaggat
gaatattctcaatggatagttgcaagtcagaggagtctcttggaggtcatggctgagttt
ccttccgtcaagcctccactaggagttttctttgcagcaatagcccctcgtttgctgcct
agatattattcaatatcatcttcaccaaggatggcaccaactagaattcatgtaacttgt
gctttagtctatggaccaacgccgacaggaaggattcacaaaggagtctgctcaacctgg
atgaagcattcaattcctatggagataagtgaagaatgcagctgggctcctatatttgtg
agacagtcgaactttaaactcccttcagatccctccacgccaattattatgattggccca
ggcacggggttggcacccttcaggggtttcttgcaggaaaggttggcactgaaggaagat
ggagcagaacttggccctgccattctcttctttggttgcaggaaccggaaaatggatttc
atctatgaggatgagctgaacaatttcgttgaggcaggggctctttctgaactaattgta
gccttttctcgtgagggtccttcaaaggaatatgtgcagcataagatgatggagaaggcc
tctgagctttggaataccatctctaatggtggatatctgtatgtctgtggtgatgctaaa
ggcatggccagagatgtccacagagttcttcatacgatagctcaagaacaggggtcgttg
gatagctcaaaggctgagcacatggtgaagagtctacagatggaaggaagatacctgcgt
gatgtctggtga

DBGET integrated database retrieval system