KEGG   Asparagus officinalis (garden asparagus): 109842111Help
Entry
109842111         CDS       T05243                                 

Definition
(RefSeq) nucleoside diphosphate kinase III, chloroplastic/mitochondrial
  KO
K00940  nucleoside-diphosphate kinase [EC:2.7.4.6]
Organism
aof  Asparagus officinalis (garden asparagus)
Pathway
aof00230  Purine metabolism
aof00240  Pyrimidine metabolism
aof01100  Metabolic pathways
aof01110  Biosynthesis of secondary metabolites
aof04016  MAPK signaling pathway - plant
Module
aof_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
aof_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
aof_M00052  Pyrimidine ribonucleotide biosynthesis, UMP => UDP/UTP,CDP/CTP
Brite
KEGG Orthology (KO) [BR:aof00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    109842111
   00240 Pyrimidine metabolism
    109842111
 09130 Environmental Information Processing
  09132 Signal transduction
   04016 MAPK signaling pathway - plant
    109842111
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:aof04131]
    109842111
Enzymes [BR:aof01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.6  nucleoside-diphosphate kinase
     109842111
Membrane trafficking [BR:aof04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    109842111
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: NDK PH TSC22 PSI_PsaJ
Motif
Other DBs
NCBI-GeneID: 109842111
NCBI-ProteinID: XP_020266612
Position
5
AA seq 454 aa AA seqDB search
MDDVYGKVEVYPNHFQDTEASVDCFPTRTRTDYSSRSRRHLQAVLKVMGAASILNLFSLP
RLPWTSNSDEDDKVELTRAEVEALRSEIIDGEERESHLKAQLEHLDEILKSAQLSGYLYI
RTRWTELPGEPPILDDVDVDDWLPRFVVLNGSCIYYYLKSTDLSPQDSTLLSDVVEIGSL
PSFTHEDGTQRYAFYILTCHGLRFECSSLSIVQSLTKMSSQICRSASRAVRSVLSASKPS
PLFFEGRAVAAATTTVFRGNMSTLSSFYERTEGRSASRGWIAGAMAAPAAAYMLQDQDAH
AAQLERTFIAIKPDGVQRGLIADIVSRFERKGFKLVAIKLVVPSKDFAQKHYHDLKERPF
FNGLCDFLSSGPVLAMVWEGEGVIKYGRKLIGATDPQKSEPGTIRGDLAVVVGRNIIHGS
DGPETAQDEIALWFEPSELVSYTSNAEKWVYGAN
NT seq 1365 nt NT seq  +upstreamnt  +downstreamnt
atggatgatgtttatggaaaagtagaagtttacccaaaccacttccaagatacagaagca
tctgtggattgtttccccacaaggaccaggactgattattcatcgagatctcgacgtcac
ttgcaggctgtgttaaaagtaatgggtgctgcatctatcttgaacttgtttagtttacca
cgtcttccatggacatccaactctgatgaagatgacaaggtcgaactaacacgtgcagaa
gtcgaagcccttcgttcagaaattatagacggagaagaaagagaatcacatctaaaggcc
cagttggaacatctagatgagattttaaagtctgcacagctttcaggatatctgtacatt
agaactaggtggacagaacttcctggagaacctcctatcttagatgatgtagatgttgat
gattggcttcctcgttttgttgttctcaatggatcatgtatctattattatctcaaatcc
actgatttgagccctcaagattccacactgttatctgatgttgtggaaattgggtcgcta
ccaagctttacacatgaagatggtacgcaaagatatgcattctacatcttgacatgccat
ggactccggtttgaatgctcgagtctttctatagtgcagtcgctgacaaagatgagctct
cagatctgccgatccgcttccagggccgtgaggtctgtgctctcggcttccaagccctcg
cctctcttcttcgaaggacgggctgttgctgcggcaacaactactgtattcagaggaaac
atgtcgacattatcttcattctatgagagaactgagggcaggagtgcctcgcgaggatgg
attgctggtgctatggctgctcctgctgcagcttacatgcttcaagaccaggacgcacat
gcagcacagctggaacgaacttttattgcaataaagcctgatggagttcaaagaggactt
attgctgacatagtctcacgtttcgagcgcaaagggtttaaacttgttgccatcaaattg
gtagttccttccaaagactttgctcagaaacactaccatgacctcaaggaaaggcctttc
tttaatggcctgtgtgactttctgagctctggtcctgtgctcgctatggtttgggaagga
gaaggtgttataaaatatggtcgaaaacttattggtgccactgatccacaaaaatctgag
cctggaactattcgaggagatctagctgtcgttgttgggagaaacatcattcacggtagt
gatgggccggaaacagcccaggatgaaattgccttgtggttcgagcctagcgagttggtt
tcttacactagcaatgccgagaaatgggtctacggcgctaactaa

DBGET integrated database retrieval system