KEGG   Asparagus officinalis (garden asparagus): 109844564Help
Entry
109844564         CDS       T05243                                 

Definition
(RefSeq) oryzain gamma chain-like
  KO
K01366  cathepsin H [EC:3.4.22.16]
Organism
aof  Asparagus officinalis (garden asparagus)
Brite
KEGG Orthology (KO) [BR:aof00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:aof01002]
    109844564
Enzymes [BR:aof01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.16  cathepsin H
     109844564
Peptidases and inhibitors [BR:aof01002]
 Cysteine peptidases
  Family C1: papain family
   109844564
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_C1 Inhibitor_I29 Peptidase_C1_2
Motif
Other DBs
NCBI-GeneID: 109844564
NCBI-ProteinID: XP_020269245
Position
6
AA seq 360 aa AA seqDB search
MARLISAAVVLLLAVVSISSAAAGSEFDKENVIRSVTDRVGSFEDNLLQVLGRTRDALHF
VRFARRHEKRYETVEEIHRRFKIFSESLDLIRSTNRKGLSYKLGINRYADLSWEEFKATR
LGAAQNCSATLRGNHKMTNEALLETKDWREDGIVSPVKDQGKCGSCWTFSTTGALEAAYI
QATGKSISLSEQQLVDCATAFNNFGCNGGLPSQAFEYIKYNGGLDTEQSYPYAAVNGICN
FRPENVGVKVLDSVNITLGAEDELKHAVGLVRPVSVAFEVVNGFRLYKSGVYSSDTCGSD
PMDVNHAVLAVGYGVENGVPYWLIKNSWGAEWGDNGYFKMELGKNMCGVATCASYPIVAP
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atggctcgcctcatctccgcagcagttgttctcctactcgccgtagtctccatttcctcg
gccgcagccgggtcggagttcgataaggagaacgtgatccgatccgttaccgatcgggtc
ggatccttcgaggacaacctccttcaggtactcggccggactcgcgatgccctccacttc
gtccgattcgctcgaaggcacgagaaaagatacgaaacggtggaggagattcatcgaaga
ttcaaaatattcagcgagagtttggatctgatccgatccaccaataggaaagggctttcc
tacaagctcggaatcaaccggtatgcggatctaagctgggaggagtttaaggcgacccgt
ttgggtgcggcccagaactgctccgcgacgttgagggggaaccataagatgactaatgaa
gctctgctcgagacgaaagactggagggaagatgggatagtcagcccagtgaaggatcaa
gggaagtgtgggtcttgctggacattcagcacaacaggtgcactggaggcagcatacata
caagcaacaggaaagagcatctccctttcagaacagcaactagtggattgtgctactgcg
ttcaataactttggatgcaatgggggcctcccttcccaagcttttgagtacataaagtac
aatggtggccttgacacagagcaatcttacccctatgctgcagttaacggcatctgcaac
tttagaccggagaatgttggagtcaaggttcttgactcagttaacatcaccctgggtgct
gaggatgagctgaagcatgcagttggattggttcgtcctgtgagtgttgcatttgaggtt
gtgaatggttttagactctacaaaagtggtgtttactcaagtgatacttgtggtagtgat
ccaatggatgtaaaccacgcagttttggctgttggttatggagtagagaacggagttcca
tactggctcatcaagaactcatggggtgcagaatggggtgacaatggatacttcaagatg
gagcttggcaagaacatgtgtggtgtggctacttgtgcatcctacccaattgttgcccca
tga

DBGET integrated database retrieval system