KEGG   Asparagus officinalis (garden asparagus): 109844790Help
Entry
109844790         CDS       T05243                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: aromatic-L-amino-acid decarboxylase-like
  KO
K01593  aromatic-L-amino-acid/L-tryptophan decarboxylase [EC:4.1.1.28 4.1.1.105]
Organism
aof  Asparagus officinalis (garden asparagus)
Pathway
aof00350  Tyrosine metabolism
aof00360  Phenylalanine metabolism
aof00380  Tryptophan metabolism
aof00950  Isoquinoline alkaloid biosynthesis
aof00965  Betalain biosynthesis
aof01100  Metabolic pathways
aof01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:aof00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    109844790
   00360 Phenylalanine metabolism
    109844790
   00380 Tryptophan metabolism
    109844790
  09110 Biosynthesis of other secondary metabolites
   00901 Indole alkaloid biosynthesis
    109844790
   00950 Isoquinoline alkaloid biosynthesis
    109844790
   00965 Betalain biosynthesis
    109844790
 09150 Organismal Systems
  09158 Development and regeneration
   04361 Axon regeneration
    109844790
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:aof04147]
    109844790
Enzymes [BR:aof01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.28  aromatic-L-amino-acid decarboxylase
     109844790
    4.1.1.105  L-tryptophan decarboxylase
     109844790
Exosome [BR:aof04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   109844790
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC
Motif
Other DBs
NCBI-GeneID: 109844790
NCBI-ProteinID: XP_020269509
Position
6
AA seq 604 aa AA seqDB search
MGSLSDPSLTTFNPLDGNSLKSHLQQTVDLILDYYKSIESLPVLPDVEPGSPLPPPLPPP
PANLPFASTLETLRRSILPGLTNXQSPNFFAYFPRHPXLRLHRRELLASAVNNVGFRLWR
LPAAAEVEGLLVGWLARVGCRRSSGSRAGVVGXFTDGERDPIVTIVAARMRGEQRGGGRR
MMSSWLMVLIETHSTFYKACKIAGFSPSNIRSIPTSSDTEFSLNPTLLLXVDEADAAGLV
PTYCLRHLGTPSNAVDPVGPIADVAKEFGAWVHVDAAYAGSAGVCPEFRKYFSGLVKADS
VSMSPHKWLLTCLDCTCLWVRDWRRLVESLGTDPEYLKNKQSESGSVVDFKDLQIGCGRP
FRALKLFMVIQTYGSAYLQAHIRSDVDMASKQVPRSLARSDPGSRGGWWPAGDCASVCFP
AWAPSVAGRCQSGRPDAAKPQAAAAGVNAAGLRVQLDPHALAGEAGANVHICVDKLLFVS
YLPANGNIVKMENQTASKVLGYGRLDLKFPFKDVSPMKTGMPQNISNENNVSVSTSILDH
MEKMINMGIYSSKSEYERSNDLDEHRRSKRVRVVKDFGSDFVTYNIDEDPIFYRSSMTLN
DAKQ
NT seq 1815 nt NT seq  +upstreamnt  +downstreamnt
atgggaagcctcagtgacccctcactcacaaccttcaaccccttagacgggaactcccta
aaatcccacctccaacaaaccgtagacctcatcctggactactacaaatccatagaatcc
ctccccgtcctccccgacgtcgaacccggctcacctctcccaccaccactccctcctcct
cccgcgaacctccccttcgcttccacgctcgaaaccctccgccgctcgatcctgccgggc
ctgaccaacntgcagagcccgaacttcttcgcgtacttcccgcgccacccttagctccgc
ctccatcgccgggaactactcgcgtcggcggtgaacaatgtggggttcaggctgtggcgt
ctcccggcggcggcggaggtggaggggctgctggtgggctggctggcaagagtgggctgc
cggaggagttcagggtcgagggcgggggtggtggggtgattcacggacggcgagcgagat
cctattgtcacgatcgttgcggcgaggatgcgcggtgagcagaggggaggcgggaggagg
atgatgagctcgtggcttatggttctgatcgagacgcattctacgttctacaaggcatgc
aaaatcgccgggttcagtccatccaacatccgatcaatccccaccagctccgacaccgag
ttctccctcaacccgaccctcctcctcncggtcgatgaggccgacgccgcggggctggtc
cccacctactgtctgcgccacctggggacaccctccaacgccgtggacccagtgggcccc
atcgccgacgtggcgaaagaattcggggcctgggtccacgtggacgctgcctacgcgggc
agcgccggagtctgcccggagttccggaagtacttcagtggattggtgaaggcggactcg
gtgagcatgagtccgcacaagtggcttttgacttgtctcgactgtacctgtctttgggtc
cgagattggaggaggttggttgagtcgcttgggactgacccggagtatctgaagaataaa
cagagcgagtcgggttcggttgtggatttcaaagatttacagattgggtgtggccgtcca
tttcgagcactcaagctcttcatggtgatccagacctacggcagcgcgtatctccaagca
cacatccgatccgacgtggacatggccagcaagcaagttccgagaagcttagcgcgctcc
gaccccggttcgaggggtggctggtggcccgcaggcgattgcgcctcagtctgctttccc
gcatgggctccaagcgtggccggacgatgccagagcgggagacccgacgcggcgaaaccg
caggctgctgcggcgggcgtcaacgcggcggggctccgcgtacagttagacccacacgct
ttggcgggagaagctggtgcaaacgtacacatttgtgttgataaattattgtttgtgtct
taccttcctgcaaatggaaatattgtgaagatggagaaccaaactgcatctaaagtgtta
ggatatggacgattggacctgaagtttccttttaaggatgtttcccccatgaaaactgga
atgcctcaaaatatctctaatgaaaataatgtatctgtctcaacttccattcttgatcat
atggaaaagatgataaatatggggatatatagttctaaatctgaatatgaaagatcaaat
gatttagacgaacatagaaggagtaagagagttagggtcgtcaaagattttggaagtgac
tttgtcacttacaatattgatgaggatcctattttctacagatcctctatgaccttgaat
gatgctaaacagtaa

DBGET integrated database retrieval system