KEGG   Asparagus officinalis (garden asparagus): 109845114Help
Entry
109845114         CDS       T05243                                 

Definition
(RefSeq) peptidyl-prolyl cis-trans isomerase CYP95-like isoform X1
  KO
K09566  peptidyl-prolyl isomerase G (cyclophilin G) [EC:5.2.1.8]
Organism
aof  Asparagus officinalis (garden asparagus)
Brite
KEGG Orthology (KO) [BR:aof00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:aof03041]
    109845114
   03110 Chaperones and folding catalysts [BR:aof03110]
    109845114
Enzymes [BR:aof01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.8  peptidylprolyl isomerase
     109845114
Spliceosome [BR:aof03041]
 Complex C
  Other components
   PPlases
    109845114
Chaperones and folding catalysts [BR:aof03110]
 Protein folding catalysts
  Peptidyl prolyl isomerase
   Cyclophilin
    109845114
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pro_isomerase
Motif
Other DBs
NCBI-GeneID: 109845114
NCBI-ProteinID: XP_020269909
Position
6
AA seq 749 aa AA seqDB search
MANPKNPIVFMDVSINGGAPGRMVFVLFSDVVPKTAENFRALCTGEMGIGRTTGKLLHYK
GSIFHRIIKGFMAQGGDFSRRDGTGGESIYGGKFADENFKLHHDGPGLLSMANAGPDGNG
SQFFITFKAAPYLDRKHVVFGKLILGQDTLKNIDQVEVNDTKPVVPVKIVDCGELQDTKK
QDKRKSSKSKSGKGVGSDTDTDIDEARQKGRHKKSSKGRKKKKRRTYYSSESDSSSDTDT
ESSETDSDSDSYSSSSLSSDISSSSDDRHRRRKKYSKRDKYKHGKRKRDPRREKRRRRRD
KKSRRKSKRISEVGDDNDDSSGSSFDSDGGKRKGLPRKSKKTNLDEVQTPLILEKGAAAN
LPSNDDNMDNPAGEGAKSLRENGEGRSNGITEAKSNSNEDRLLPIDNIPTKSRSQSISPT
RSMSKSITPRRSQSKSPSMSPKRSISRSMSRSPARSMSKSPVKSCHRSISRSSARSPPRR
SPGVSQSPARDKRRSVSRSSARIYRRRSISRSPMMDARKSISRSPIRSSRRSPSRSPIRT
WSRRSISRSPVGRHGRSFSRSASPREVPKRIQKGRGFSPTYSFARRYRTPSPDRSPVRSY
RYGGRTDRDRYPRYRSFYDRSPPRRYRSPPSRYRSRRSRTRSISRSPLTYRGRRSPLRSR
SPVEKRRSRSGRRRSVSPSQSLSGSRSRSRSISRSRSISRSRSRSSLDTPSPKRVSKEKS
LSRSPSSSSHGKKGLVSYGDASPDSAGQK
NT seq 2250 nt NT seq  +upstreamnt  +downstreamnt
atggccaatccaaagaacccaattgtgttcatggatgtatcaattaatggcggtgcaccg
ggaaggatggtttttgtgcttttttctgatgttgttcccaagactgctgagaacttccgt
gcattatgtactggtgaaatgggaattggacgtacgactgggaagctcctgcattacaag
ggatcaatattccatcgcataatcaaagggttcatggcacagggtggtgacttttctagg
cgagatggaacaggtggtgagagtatatatggtggaaaatttgctgatgaaaattttaag
ctacaccatgatggccctggtcttctgtcaatggcgaatgctggacctgatggcaatggt
tctcaattttttatcaccttcaaagctgctccttaccttgacaggaagcatgttgttttt
gggaaacttatactaggacaagacactttgaagaatatagatcaggttgaagttaatgat
accaaacctgttgttcctgtgaaaattgttgactgtggtgagcttcaggatacaaaaaag
caagataaaaggaaatctagtaaatcaaaatcaggaaaaggtgtcggttctgatacagat
acagatattgatgaagcacggcaaaaggggcgtcataagaaatcttctaaaggccgaaaa
aagaagaagcgaagaacatattattcatctgaatcagatagctcatcagatactgacact
gaatcttcagagactgatagtgattctgattcatattcatcatcatcattatcatctgat
atcagtagctctagtgatgataggcataggaggagaaagaaatattccaagagggataaa
tacaagcacggaaaacggaaaagggacccaaggcgcgagaaaagacgtagaaggcgtgac
aaaaaatcaagacgcaaatcaaagaggatatcagaggttggtgatgataatgatgattca
agcgggagcagctttgacagtgatggtggtaaacgtaaaggactaccacggaagtctaaa
aaaacaaatctggatgaagttcagaccccattgattttggagaaaggagctgctgcaaac
ttgccaagcaacgatgacaacatggacaatcctgctggagaaggagctaaatctttgaga
gaaaatggagaggggaggagcaatggaatcactgaagcaaaatctaacagcaatgaagat
agactgctgcctatcgataatataccaaccaaatctaggagtcaaagcataagtcctact
cgatccatgagcaagagcataactcccagaaggagccaaagcaaaagcccgagtatgagt
cccaagaggtctatcagcaggagcatgagtcgaagcccggctagaagcatgagcaaaagc
ccagtaaaaagttgtcatagaagcataagcagaagctcagctagatctccgcctcgaaga
agtccaggtgttagccagagccctgcaagggacaagagaaggagcgtaagcaggagctct
gcaaggatttaccgaagaagatccataagcagaagcccaatgatggatgctcgtaaaagc
atcagcagaagccctataaggtcatcaagaagaagcccaagtcgaagcccaatcaggact
tggtcacgaagaagcatcagcagaagtccagtgggtcgccatggtaggagtttttccaga
agcgcttctccacgtgaggtgcccaagcgaattcaaaagggccgtggctttagtccgaca
tattcttttgccagacgataccgaactccttctccagaccgttctcctgttaggtcttat
cgatatggtggaaggactgatcgtgataggtatccgagatatagaagcttttatgacagg
tctccccctaggcggtacaggagtcctccaagcaggtacagaagcaggagaagccgcact
cgaagcatttcacgcagccccttaacttaccgtggccgtcgtagtcctcttcgtagtcga
tctcctgtggagaaacgaaggtcccgctctgggaggcgcaggtctgtttccccaagccaa
agcctatctgggtcccgctcccggtcccgatccatttcaagatccaggtcgatatctagg
tctaggtctaggtcatctctcgatactccctctccaaagcgcgtgagcaaggagaaatct
ttgtcaagatcaccttcaagtagttctcatgggaagaagggcttggtttcttatggtgat
gcctctcctgattctgctgggcaaaagtag

DBGET integrated database retrieval system