KEGG   Asparagus officinalis (garden asparagus): 109848280Help
Entry
109848280         CDS       T05243                                 

Definition
(RefSeq) dnaJ protein homolog
  KO
K09503  DnaJ homolog subfamily A member 2
Organism
aof  Asparagus officinalis (garden asparagus)
Pathway
aof04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:aof00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    109848280
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:aof03110]
    109848280
   03029 Mitochondrial biogenesis [BR:aof03029]
    109848280
Chaperones and folding catalysts [BR:aof03110]
 Heat shock proteins
  HSP40 / DNAJ
   109848280
Mitochondrial biogenesis [BR:aof03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    109848280
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DnaJ_C DnaJ DnaJ_CXXCXGXG Anti-TRAP HypA TackOD1
Motif
Other DBs
NCBI-GeneID: 109848280
NCBI-ProteinID: XP_020273296
Position
7
AA seq 416 aa AA seqDB search
MFGRAPKKSDNTKYYEILGVSKNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV
LSDPEKREIYDQYGEDALKEGMGGGGGHDPFDIFQSFFGGSPFGGGGSSRGRRQRRGEDV
IHPLKVSLEDLYNGTSKKLSLSRNVICSKCKGKGSKSGASMKCPGCQGSGMKVSIRQLGP
GMIQQMQHPCNECKGTGETINDRDRCPQCKGEKVVQEKKVLEVVVEKGMQNGQKITFPGE
ADEAPECVTGDIVFVLQQKEHPKFKRKGDDLFYEHTLSLTEALCGFQFVLTHLDNRQLLI
KSNPGEVVKPDQFKAINDEGMPMYQRPFMRGKLYLHFTVDFPDFLSPEQCKVIETVLPPR
TSSQLTDMELDECEETTMHDVNIEEEMRRKQAQAQEAYDEDEDTHGGAQRVQCAQQ
NT seq 1251 nt NT seq  +upstreamnt  +downstreamnt
atgttcgggagggcgccgaagaagagcgacaacacgaagtactacgagatcctcggggtc
tcgaagaacgcgtcgcaggacgatctgaagaaggcttataggaaggctgcgatcaagaat
catcctgacaagggaggcgatcctgagaagtttaaggagctggctcaggcatacgaggta
ttgagtgaccctgaaaagcgtgagatatatgatcaatatggcgaggatgccctcaaggaa
ggaatgggtggtggtggtggccatgacccatttgacatcttccagtccttctttggtgga
agtccctttggaggaggtggcagcagccggggccgcaggcagaggagaggagaggatgtc
atccatcctttgaaagtttctctcgaagacctttacaatggaacctcaaagaagctctcc
ctctctagaaatgttatctgctcaaaatgcaaggggaagggatccaaatctggcgcttca
atgaaatgtccaggttgccaaggttctggcatgaaggtatccattcgtcagttgggtcct
ggcatgatccagcagatgcagcatccttgcaatgaatgtaaaggaactggggagacgatt
aatgacagggacaggtgcccacagtgcaaaggggaaaaggttgtgcaggagaagaaagtg
ttggaggtggttgtggagaaagggatgcagaatggtcagaagatcactttccctggagaa
gcagatgaagcgcctgagtgcgtcacaggtgacatagtgtttgtcctccagcagaaagag
catcccaagttcaagagaaagggcgacgatctcttctatgagcatactctctctttgact
gaggctctctgtggcttccagtttgtgctgacacatcttgataaccggcagctgctcatt
aagtctaatcctggcgaggtcgtcaagccagatcaattcaaggccatcaatgacgaagga
atgccaatgtaccagaggccgttcatgagaggaaaactctacctccacttcaccgttgac
ttcccagatttcctctctcctgagcagtgcaaggtgatcgagactgtgcttcctccaagg
acttcatctcagctcaccgacatggagcttgatgaatgcgaggagacgacgatgcatgat
gtcaacatagaggaggagatgaggaggaagcaggcacaagctcaggaggcctacgatgag
gatgaagatacgcatggcggtgctcagagggtgcagtgcgctcagcagtag

DBGET integrated database retrieval system