KEGG   Asparagus officinalis (garden asparagus): 109848393Help
Entry
109848393         CDS       T05243                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: cystathionine gamma-synthase 1, chloroplastic-like
  KO
K01739  cystathionine gamma-synthase [EC:2.5.1.48]
Organism
aof  Asparagus officinalis (garden asparagus)
Pathway
aof00270  Cysteine and methionine metabolism
aof00450  Selenocompound metabolism
aof00920  Sulfur metabolism
aof01100  Metabolic pathways
aof01110  Biosynthesis of secondary metabolites
aof01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:aof00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    109848393
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    109848393
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    109848393
Enzymes [BR:aof01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.48  cystathionine gamma-synthase
     109848393
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Cys_Met_Meta_PP Aminotran_5 Beta_elim_lyase
Motif
Other DBs
NCBI-GeneID: 109848393
NCBI-ProteinID: XP_020273447
Position
7
AA seq 503 aa AA seqDB search
MALFLNPNPSFIPSSPMSASAAGGNPRSFKKSPFSNGYGLSSALILKFPPNFVRQLSIKA
RRNCGNIGVAQVVAASWANSPSADEELQKVVECEYCEVVDSVQSQIGGLGAAFSSDASLL
VHAGERYGRRLKTDTITTPIVNTSAYWFKNCDELIDFKEGRHTSFEYGRYGNPTTEVLER
KMSELERAETTLFVSSGMYASCAVLSALVPAGGHIVTTTDCYRKTRMFIENELPKKGIKA
TVIAPADMGSLERALCENEVSLFFTESPTNPFLRCIDIRLVSELCHSKGSLVCIDSTFAS
PVNQKPLTLGADLVIHSATKFIAGHNDVIAGCVSGSEELVSKVRQYHHIIGGVLDPNAAY
MISRGMKTMHLRVQYQNSIALRMAQFLEEHPKILRVYYPGLPSHPEHHIAKQQMTGFGGV
VSFELAGGLLETVKFIDSLKIPYLAPSFGGCESIVEPPAIMSYWDSNLDRDKYGIGENLI
RFSFGVEDFDDLKADIAKGLEAI
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
atggctctcttcttaaaccctaaccctagcttcatcccctcctctccaatgtccgcctct
gcggccggcggaaaccctagatccttcaagaaatcgccattttcgaacggttacggcctc
tcctcagctctcatcctcaagttcccgccgaatttcgttcgccagctcagcatcaaggct
cgccggaactgcggcaacatcggagttgctcaggtcgtcgcggcctcttgggccaactcg
ccgtctgccgatgaggaattgcaaaaggttgtggaatgtgagtattgcgaggttgtagat
agtgtacagagtcagatcggtggtttgggagctgcgtttagctcggatgcgagccttttg
gttcatgctggagagagatatggacgccgtctgaagacggatacgatcaccacacccatt
gtcaacacttctgcgtactggtttaagaactgcgatgagctgattgatttcaaggagggt
aggcatacaagctttgagtatgggcgatatgggaacccaactaccgaggtattggagagg
aagatgagtgaactggagagggcggaaactactttgtttgtgtcctctggcatgtatgcc
agttgtgcggtgctctcggccttggttcctgcaggtggccatatcgttacgaccactgat
tgctataggaagacaaggatgttcattgagaatgagcttccaaagaaggggattaaggct
accgttattgctcctgctgatatgggctctcttgaaagagcactgtgcgaaaatgaagtg
tctcttttctttacggagtccccaactaatccattcctccgatgcattgatatcaggttg
gtttcagagctttgccacagcaaaggatctctggtttgcatagatagcacatttgcctca
cctgtcaatcaaaagcccttaactttgggagctgacctagtcattcattctgcaacaaag
tttattgccggtcacaatgatgtgattgccggttgtgtcagtggttcagaggaattggtt
tccaaagttcgccagtatcatcatattattggtggtgttcttgatcctaatgctgcatat
atgatctcccgaggtatgaagacgatgcaccttcgtgtacagtatcagaatagtatagca
ttgaggatggcccagtttttagaggaacatcccaagattttacgtgtatactatccagga
ctgccaagtcatccagagcatcatattgccaagcagcaaatgactggttttggtggtgtg
gtcagttttgagctagctggaggcttgttggagacggtaaagttcattgattctttgaaa
ataccatatctcgccccttcttttggaggttgtgagagtatagtggaaccaccggctatt
atgtcttactgggatagcaatttggatagagacaagtatggcatcggtgaaaacctgatc
aggttcagttttggagtggaggacttcgatgatttgaaggctgatatagccaaaggccta
gaagccatataa

DBGET integrated database retrieval system