KEGG   Asparagus officinalis (garden asparagus): 109848464Help
Entry
109848464         CDS       T05243                                 

Definition
(RefSeq) guanine nucleotide exchange factor SPIKE 1 isoform X1
Organism
aof  Asparagus officinalis (garden asparagus)
SSDB OrthologParalogGFIT
Motif
Pfam: DHR-2 DOCK-C2
Motif
Other DBs
NCBI-GeneID: 109848464
NCBI-ProteinID: XP_020273557
Position
7
AA seq 1840 aa AA seqDB search
MEDSSSDGSRFRRIPRQLWTSNLELDSVINENLEQWPHLNEVVQCYKADWVKDENKYGHY
ESVAPLSLQNQVFEGPDTDIETEMHLANARQSKTEEATDDDGPSTSGRQINEHFGQSPLP
AYEPTFDWENERSMFFGQRISEALPAQHCSGLKITVKVLSLSFQAGLTEPFSGTICLYNR
ERREKMSEDFYFHVLPTELQDASISSERRGVFSLDAPSASVCLLIQLEKPATEEGGVTSS
VYSRKEPVHLTEREKQKLQVWSRIMPYKESFAWAIVPLFENNNPMASGGSASPSSPLAPS
ISGSSSQDSVVESVMKNTLDGKLAQYSSGSSVIVEISNLNKVKESYTEDSLQDPKRKVHK
PVKGVLRLEVEKLHMTNVDADNLSESGSLTNEPNDAAGRFAEPSSAKYLGNGSDGLRTGN
LKFNASDKKESHRNVPNMIPGSCLDSNSDEVFQAFDFRMMTRNEPFPQLLHCLYLYPLTV
SLSRKRNLFIRVEMRKDDSDIRKQPVEAMCPRNPGGGLQKWAHTQVAVGARLACYHDEIK
ISLPALLTPQHHLLFTLFHVDLQTKLEAPKPVIIGYAALPLSSHIQLQADISLPILRELV
PHYLQDGGKERVDYLEDGKNVFKLRLRLCSTLFPLNERIRDFFLEYDRHILRTSPPWGSE
LLEAINSLKNVESTALLQFLQPILNMLLHLIGDGGETLQVAAFRAMVNILTRVQQESSDG
ADRNRFLVNYVDYAFDDFGGRQAPVYPGLSTVWGSLARSKAKGYRVGPVYDDVLAMAWFF
LELIVKSMALEQSRLFYHNLPLGEDIPPLQLKEGVFRCIMQLYDCLLTEVHERCKKGLSL
AKRLNSSLAFFCYDLLSIIEPRQVFELVSLYMDKFAGVCQSVLHECKLTFLQIICDHDLF
VEMPGRDPSDRNYLSSILIQELFLTWDHDDLSQRAKAARILVVLMCKHEFDSRYQKREDK
LYIAQLYFPLIGQILDEMPVFYNLNSIEKREVLVVVMQIIRNLDDATLVKAWQQSIARTR
LFFKLLEECLILFEHKKAADSLLMSCSSRSPDTEGPASPKYSDRLSPAINTYLSEASRQE
VRVQPHGTPENGYLWNRVSPQFSSPSQPYSLREALAQAQSSRIGSSTRALRESLHPVLRQ
KLEIWEENLSTTISLQVLEMTEKFSVAAASHSIATDYGKLDCITSILMSLFSRNQPLAFW
KALCPVFNNIFNLHGATLMARENDRFLKQVAFHLLRLAVFRNDSIRRRAVIGLQILIRSS
FYYFVHTTRLRVMLTITLSELMSDVQVTQMRSDGSLEESGEARRLRKSLEELADEDRSRE
LIRDCGLPACALEAVSEGSTDDRWSWSEVKHLSDSLLQALDAGLEHALLASVMTIDRYAA
AESFYKLAMAYAPVPDLHIMWLLHLCDAHQEMQSWAEAAQCAVAVAGVIMQALVGRNDAV
WSRDHVAALRKICPMVSTAVTGEASAAEVEGYGASKLTVDSAVKYLQLANKLFSQAELHH
FCASILELIIPVYKSRRSFAQLAKCHTSLTNIYESILEQEASPIPFTDATYYRVGFYGDR
FGKLDRKEYVYREPRDVRLGDIMEKLSHIYESRMDANHTLHIIPDSRQVNAEELQPGVCY
LQITAVDPVMEDEDLGSRRERIISLSTGGVRARVFDRFLFDTPFTKNGKTQGGLEDQWKR
RTVLQTEGSFPALVNRLVVTKSESLEFSPVENAIGMIETRTAALRNELEEPRSSEGDQLH
RLQSLQRILQGSVAVQVNSGVLSVCTAFLSGEPATRLRSQELQQLIAALLEFMAVCKRAI
RVHFRLIGEEDQDFHTQLVNGFQSLTAELSHYIPAILSEL
NT seq 5523 nt NT seq  +upstreamnt  +downstreamnt
atggaggattcttcaagtgatgggagtcgatttcggagaatacctcgtcaactgtggact
tctaatctggagctcgattctgtgataaatgaaaatttggagcagtggccgcatctaaat
gaggtggtacagtgctataaagctgattgggtgaaggacgagaataagtatgggcactat
gaaagtgttgcgcctttgtcattacagaatcaagtttttgaagggcctgacacggacata
gaaacagaaatgcatcttgccaatgcaaggcagtccaaaactgaagaggcaactgatgat
gacggtcccagcacctcaggaagacagataaatgagcattttggccaatctccactgcca
gcatatgaacctacatttgactgggaaaatgaaagatcgatgttttttggacaaaggatc
tctgaagctcttccagctcaacattgcagcggattgaagattactgtgaaggtactatcc
ttgtctttccaggctggattaactgagcccttctctggtacaatttgcctatataacagg
gagagaagagaaaaaatgtcagaggacttctattttcatgttctgccaacagagttacag
gatgctagcatttcttcagaacgtaggggagttttctctttagatgctccttcagcatct
gtttgcctcctcattcagctagagaagcctgctacagaagaagggggtgttacttcatcc
gtttattcacgaaaggaacctgttcatttgacagagagagaaaagcagaaactgcaggta
tggtctcgaatcatgccatacaaggagtcatttgcttgggctattgttccactctttgag
aacaacaatcccatggcgtcaggtggttctgcttcccctagcagtcctcttgctcccagc
atatctggctcaagctcccaagacagtgttgtggaatctgttatgaaaaatactttagat
ggcaagttggctcagtattcaagtggaagttcagttattgttgagatatcaaacttgaat
aaagtcaaagaaagctacacagaggactcacttcaggaccctaaaaggaaggtacacaag
cctgtgaaaggtgtactcagattggaagttgaaaagcttcatatgactaatgtggatgct
gataacctttctgaaagtggaagtctaacaaatgaaccaaatgatgctgctggccgtttt
gcggagccttcttccgcaaagtatcttggtaatggttctgatggattacggaccggtaac
ttgaagtttaatgccagcgataaaaaggaatcacacagaaatgttccaaatatgatacca
ggaagttgtctcgacagcaatagtgatgaagtattccaagcttttgattttcgcatgatg
actagaaacgaaccatttccgcaacttttacattgtctttatctatatcccctgaccgtc
agtttgagccgcaaaaggaatttattcattagggtggaaatgaggaaggatgactctgat
attcgtaaacagccagtagaggccatgtgtccaagaaatcctggcggcggtctccaaaaa
tgggcgcacacacaagttgctgtgggtgctaggctggcctgctaccatgatgagattaaa
atttctcttcctgctcttttgacacctcaacatcatcttttattcacattattccatgtt
gatctccaaacaaagctagaagctcccaagcctgtaattataggatatgctgccctcccc
ttgtccagccatattcagctgcaggctgacatttctttaccaattctaagagagctagtt
ccacattatctgcaagatggagggaaggagagagtggattatctagaggatggaaagaat
gtcttcaaactacgactaaggctgtgctctacattatttccactcaatgagagaattaga
gatttctttcttgagtatgaccggcacatccttcggactagccctccttggggttctgaa
ctcctagaggccattaatagcttgaagaatgttgaatctactgccttgttgcaatttctt
cagccaattcttaatatgcttcttcatttgattggtgatggtggagaaacccttcaggtt
gcagcatttcgagccatggtcaatattctgacacgggtacaacaagagtcctctgacggt
gctgatcggaatcgctttcttgtcaactatgttgattatgcttttgatgacttcggcggt
cggcaagcaccagtttatcctggtttgtcgacggtgtggggaagtctagctcgcagtaag
gcaaaaggctaccgtgttgggccagtttatgatgatgttctggcaatggcatggttcttc
ttggagcttattgtgaagtcaatggcactagagcaaagtcgccttttctaccacaatctt
ccactaggtgaagatattccaccattgcagttgaaagaaggtgtattccgctgtatcatg
cagctttatgattgcctgttgacggaggttcatgaacgctgcaagaagggtttaagcttg
gcaaaacgtctaaacagcagtcttgccttcttttgttatgatctgttgtcaatcattgag
ccacgccaagtgtttgagctggtgtccttgtacatggacaaatttgctggggtctgccaa
tctgtgttgcacgaatgcaagcttacctttttgcagataatatgtgatcacgatcttttt
gtggaaatgccagggcgagatccttcagatagaaattatctctcatctattcttattcaa
gagcttttcctcacatgggatcatgatgatttatctcagcgtgcaaaagctgctcgcatc
ttggtagtcctcatgtgcaagcatgaatttgattctcgctaccagaagcgtgaggataaa
ttatatattgctcagctgtactttcctcttatcggacagatacttgatgaaatgccagta
ttctataatctaaattctattgaaaaacgtgaagtgttggttgtcgttatgcaaatcata
aggaatctagatgatgccacccttgtcaaggcatggcaacaaagcattgctcggaccaga
ttatttttcaaactcctagaagaatgtcttattctctttgagcataaaaaagcagcagac
agtttactcatgagctgcagttctcgtagccctgacactgaaggacctgcttctccaaag
tattctgatcgactgtctccagcaatcaatacctatctatctgaggcttctcgtcaagaa
gttagggtacagcctcatggaactcctgaaaatggctatttgtggaatagagtcagtcct
caattcagctcgccaagccaaccatattctttaagggaagctcttgcacaggctcaatct
tctagaatcggatcttcaaccagggcactgagggaatctttgcatccagtattgaggcag
aagctggaaatctgggaagagaatttaagtaccactattagtctccaggtcttggagatg
actgaaaagttttcagttgctgctgcatcccatagtattgctactgactatggaaaatta
gattgcattacctccatattgatgagcctcttttctcgaaatcagccattggccttttgg
aaggctttgtgtcctgtgttcaataatatttttaatcttcatggtgcgacactgatggca
agagagaatgaccggttcttgaagcaagttgcttttcatcttctaagacttgcagtattc
cgtaatgattccatcaggagaagggctgttattggattgcaaatacttattaggagttca
ttttattattttgtgcataccacacggttgagggtgatgttgacaattaccttgtcagag
ttgatgtctgatgtacaagttacacaaatgaggtcagacggatctcttgaagagagtggt
gaagctagacgtcttaggaaatcattggaagagttggctgatgaagataggagcagggag
cttataagagactgtggcctccctgcctgtgcacttgaggcagtttctgaaggatcaact
gatgaccgttggtcttggtcagaagtcaaacatttgtcagacagtcttcttcaagcactt
gatgcaggattagagcatgccctgttggcttctgttatgactattgatagatatgcagct
gctgagagcttttataagcttgcaatggcgtatgcacctgttccagatcttcacattatg
tggttactgcatttatgtgatgcacatcaagagatgcaatcatgggctgaagctgctcaa
tgtgcagttgctgttgctggtgtgatcatgcaggcccttgttgggaggaatgatgctgtt
tggagcagagatcatgtagcagctttgcgcaagatttgcccaatggtcagcactgcagtg
actggtgaggcatcagctgctgaggtagaaggatatggtgcgtcaaaactgactgtggat
tctgctgtgaagtacttgcagcttgcgaataagctcttttcacaggctgagctacatcat
ttttgtgcgagcatcttggaactcataatccctgtttataagagcaggaggtcatttgct
caacttgctaaatgccacacatccctcacaaacatctacgaatcaattttggagcaggaa
gcaagtccaattcctttcacagatgccacttattatcgggttggattttatggtgatcgt
tttggtaagctagataggaaagaatatgtatacagagagccacgagatgtacgtctaggt
gacataatggaaaagctgagtcacatatatgaatccaggatggatgccaatcacactctt
catataataccagattcccgacaagtaaacgcagaggaattacagcctggtgtctgttac
ctgcagataactgcagtggacccagttatggaagatgaggatttgggcagcaggagagag
aggatcatctctttatccactggaggtgtaagagctcgggtttttgatcgttttttattt
gataccccattcactaaaaatggcaagacgcaaggtggattagaagatcaatggaagcga
cgtactgttctccagacagagggctcctttcctgcacttgtaaatcgtcttgtggttact
aagtctgaatccttagagttctcaccagtagagaatgctatcggaatgattgaaaccagg
acagcagcgctgaggaatgagctggaagaacctcgtagctcagaaggagatcaattacac
aggcttcaaagtttacagagaatacttcaaggcagtgttgcggtacaggtgaatagtgga
gtacttagcgtctgcacggcatttctctctggtgaacctgcaaccaggcttaggtcacag
gaactgcagcagctaattgctgcgcttttagagttcatggctgtatgcaagcgtgcaata
cgtgtccattttagattgattggggaagaagaccaggactttcatactcagctcgtgaat
ggttttcaatccttaacagctgagctttctcactatattcctgccatactatcagagctc
tga

DBGET integrated database retrieval system