KEGG   Asparagus officinalis (garden asparagus): 109848719Help
Entry
109848719         CDS       T05243                                 

Definition
(RefSeq) cyclin-dependent kinase D-1-like
  KO
K02202  cyclin-dependent kinase 7 [EC:2.7.11.22 2.7.11.23]
Organism
aof  Asparagus officinalis (garden asparagus)
Pathway
aof03022  Basal transcription factors
aof03420  Nucleotide excision repair
Brite
KEGG Orthology (KO) [BR:aof00001]
 09120 Genetic Information Processing
  09121 Transcription
   03022 Basal transcription factors
    109848719
  09124 Replication and repair
   03420 Nucleotide excision repair
    109848719
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:aof01001]
    109848719
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:aof03021]
    109848719
   03019 Messenger RNA biogenesis [BR:aof03019]
    109848719
   03400 DNA repair and recombination proteins [BR:aof03400]
    109848719
Enzymes [BR:aof01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     109848719
    2.7.11.23  [RNA-polymerase]-subunit kinase
     109848719
Protein kinases [BR:aof01001]
 Serine/threonine kinases: CMGC group
  CDK family
   109848719
Transcription machinery [BR:aof03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIH
     109848719
Messenger RNA biogenesis [BR:aof03019]
 Eukaryotic type
  mRNA processing factors
   5' end processing
    Capping factors
     109848719
DNA repair and recombination proteins [BR:aof03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    TFIIH complex
     109848719
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr RIO1 Haspin_kinase
Motif
Other DBs
NCBI-GeneID: 109848719
NCBI-ProteinID: XP_020273956
Position
7
AA seq 443 aa AA seqDB search
MAMMASSSSQQQQQNLQSLNPNRGGGGGEEDKGEKIVADRYLKRELLGEGTYGVVFKALD
TKTGQTVAIKKIRLGKHKEGVNFTALREIKLLKELKDPNIIELIDAFPHKGNLHLVFEFM
ETDLEAVIRDRNILLSPADIKSYMQMTLKGLAVCHKKWVLHRDMKPNNLLISADGQLKLG
DFGLARIFGSPDRKFTHQVFARWYRAPELLFGSKQYGPGVDVWAAGCIFAELLLRRPFLQ
GSSDIDQLGKIFAAFGTPKPSQWADMVYLPDYVEYQHVPAPSLRSLFTASDDALDLLSRM
FTYDPKARISAQQALEHRYFSSQPLPTIPEKLPRPHRKGDSLNHYPSDFVSQDAPLVLSP
SRKMRRVTPHHGAFEGNAHEKAGHARDSRHVGESTGPSGNILMSIDFEALHGSRPPPRPT
LNSADRSHLKRKLDLDPDFGYSH
NT seq 1332 nt NT seq  +upstreamnt  +downstreamnt
atggcgatgatggccagctcttcatcgcagcagcagcaacaaaatcttcagagtctaaat
ccaaaccgcggcggcggcggcggcgaagaggacaaaggggagaagattgtggccgaccgt
tatttgaagagggagctcctcggtgaaggaacctatggcgtcgtcttcaaagccctagat
accaagacaggacagacagttgcaattaagaagattcgtctggggaagcacaaggaaggt
gtaaattttactgctctgagggaaattaaactcctcaaggagctcaaggatccaaatatt
atcgagctaattgatgcttttcctcacaagggtaacttgcatcttgtatttgagttcatg
gagaccgatttggaagctgttattcgtgatcggaatattctgctgtctccagctgatatt
aaatcttacatgcaaatgacactgaaagggcttgcagtttgccataaaaagtgggttttg
cacagggatatgaagcctaacaacttgctgatttctgcggatggccaactgaagcttggt
gactttggtctggcacgcatttttggcagtccagatcgcaaatttactcaccaggtcttt
gctcgctggtatagagcacctgaattattattcggcagcaagcagtatggtcccggagtg
gatgtgtgggctgcaggctgcatatttgctgaactccttctaaggcggccatttctgcag
ggttcaagtgacatcgaccagcttgggaagatctttgcagcttttgggacaccaaagcca
tctcaatgggctgacatggtttaccttccagattatgtcgaatatcagcatgttcctgca
ccttcattacgctccctgtttacagctagtgatgatgctttagaccttttatcaaggatg
ttcacctatgatccaaaagcaaggatctctgcccaacaggctcttgagcacaggtatttt
tcttcccaaccactaccaacaataccggaaaagctcccaaggccacaccggaagggagat
tcattaaatcactatccttcagactttgtttcacaagacgctcctcttgttttatctcca
tcgagaaaaatgaggagggtgacaccccatcatggggcatttgaaggaaatgcacatgaa
aaggctggtcatgcgagggacagtagacatgtaggcgagagtactgggccgagtggaaat
atcctaatgtcaatagatttcgaagcccttcatggctcacgaccccctccaaggccaact
ctaaatagtgccgataggtctcacctcaagagaaaacttgatttggatcctgacttcgga
tattctcactga

DBGET integrated database retrieval system