KEGG   Asparagus officinalis (garden asparagus): 109848798Help
Entry
109848798         CDS       T05243                                 

Definition
(RefSeq) heat shock cognate 70 kDa protein 2-like
  KO
K03283  heat shock 70kDa protein 1/2/6/8
Organism
aof  Asparagus officinalis (garden asparagus)
Pathway
aof03040  Spliceosome
aof04141  Protein processing in endoplasmic reticulum
aof04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:aof00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    109848798
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    109848798
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    109848798
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:aof01009]
    109848798
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:aof03041]
    109848798
   03009 Ribosome biogenesis [BR:aof03009]
    109848798
   03110 Chaperones and folding catalysts [BR:aof03110]
    109848798
   04131 Membrane trafficking [BR:aof04131]
    109848798
   03051 Proteasome [BR:aof03051]
    109848798
   03029 Mitochondrial biogenesis [BR:aof03029]
    109848798
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:aof04147]
    109848798
Protein phosphatases and associated proteins [BR:aof01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     109848798
Spliceosome [BR:aof03041]
 Complex B
  Other components
   Prp19 complex
    109848798
 Complex C
   Prp19-CDC5 complex
    109848798
Ribosome biogenesis [BR:aof03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    109848798
Chaperones and folding catalysts [BR:aof03110]
 Heat shock proteins
  HSP70 / DNAK
   109848798
Membrane trafficking [BR:aof04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    109848798
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    109848798
Proteasome [BR:aof03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    109848798
Mitochondrial biogenesis [BR:aof03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    109848798
Exosome [BR:aof04147]
 Exosomal proteins
  Proteins found in most exosomes
   109848798
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HSP70 MreB_Mbl DDR FGGY_C Hydantoinase_A
Motif
Other DBs
NCBI-GeneID: 109848798
NCBI-ProteinID: XP_020274062
Position
7
AA seq 619 aa AA seqDB search
MAGKGEGPAIGIDLGTTYSCVGVWQHGRVEIVANDQGNRTTPSYVAFTDSERLIGDAAKN
QAAINPTNTVFDAKRLIGRHFSDASVQSDTELWPFKVIPGPGDKPMIVVRYKEEEKQFAA
EEISSMVLIKMKEIAEAYLGCTVKNAVVTVPAYFNDSQRQATKDAGLIAGLNVMKIISEP
TAAAIAYGLDHKTTSVGESNVLIFDLGGGTFDVSLLTIEKGIIKVKTTAGDTHLGGEDFD
NRMVKHFIQEFKRKSTKDITCNPRALRRLRTACEKAKRFLSSTPETTIEIDCLYEGIDFY
STITRARFEELNMDLFSKCIELVEKCLRDAEMDKSAVHDVVLIGGSTRINKVQQLLRDFF
NGKELCKGINPDEAVAYGAAVQAAMLSGEGDKIVQNLLLLDVTPLSLGLQTRGEIMTVFI
PRNTTIPTKKEKELYTSYDNQTSVSFPVYEGERMKSTDNNLLGQFELCGIPPAPRGRAQF
TACFEIDVNGILSVSAEDKSTGQKKKITITCEKDRLSKEEIERMVREADKFKSEDEARKK
KVQAKNALEDYAYYMRNSIREAKIASKLAEADRKRIEDLFDQTMRWLDTKQSAEAAEFQD
KKWELQISFNPILAKVNQG
NT seq 1860 nt NT seq  +upstreamnt  +downstreamnt
atggcgggaaagggagagggtccggcgatcgggatcgatctcgggacgacgtactcctgc
gtcggagtctggcagcacggtcgggtggagatcgtcgccaacgaccaggggaacaggacg
acgccgtcctacgtggcgttcaccgactccgagaggctgatcggcgacgcggcgaagaac
caggccgccattaacccgaccaacaccgttttcgatgcaaagcgtttgataggaaggcat
ttcagtgatgcgtctgtccagagtgacaccgagttgtggcccttcaaggtcattcctggc
cctggagacaagcccatgatcgttgtccggtacaaggaagaggaaaagcagtttgctgct
gaagaaatttcttcaatggttttgattaagatgaaagaaatcgctgaggcataccttggc
tgtaccgtcaagaatgctgtggtcacagtccctgcttatttcaatgattcacaacgtcag
gccaccaaggatgctggcctcattgcagggcttaatgttatgaaaatcatcagcgagccg
actgctgctgctattgcctatggtcttgaccataagacgactagcgttggtgagagcaac
gtcctcatctttgacctcggtggtggtacgtttgatgtttcccttcttaccattgagaag
ggtatcatcaaggtcaagactactgctggtgacacccatcttggaggagaggacttcgac
aaccgaatggtgaagcatttcattcaggagttcaagagaaagagcacaaaggacatcacc
tgcaaccccagggctcttaggagattaagaacagcttgtgagaaggcgaagaggtttctc
tcctccacccctgagaccacaattgagatcgattgcctctatgagggtattgatttctac
tcaaccatcaccagggccagatttgaggagctgaacatggatctttttagcaagtgtata
gagctagtggagaagtgcttgagggatgccgagatggataagagcgctgtccatgatgtg
gtgcttatcggggggtccaccaggattaacaaggtccagcagttgcttcgggatttcttc
aacgggaaggagctctgcaagggcatcaaccctgatgaggcagtcgcctatggtgctgca
gtgcaagctgcaatgttgagcggtgaaggcgacaagatcgtgcaaaatttgctgttgttg
gacgttactcctctctcccttggactacagactcgtggggagattatgaccgttttcatc
ccaagaaacaccaccattcctaccaagaaggagaaggaactctatacttcctacgacaac
caaacctctgtctccttcccggtgtatgaaggtgagaggatgaaatcaacggacaacaac
ttgctcggccagtttgagctctgtggcatccctcctgctcctcggggtcgtgctcagttc
actgcctgctttgagatcgatgtcaacggcattctgagcgtctctgctgaggacaagagc
accggtcaaaagaaaaagatcaccatcacctgtgaaaaggacaggctgagcaaggaggag
attgagaggatggtgagggaggctgacaagttcaagtctgaggacgaggcacgcaagaag
aaggtgcaggccaagaacgccctcgaggactacgcctactacatgaggaactccatcagg
gaagccaagattgcttcgaagctggcagaggctgataggaagaggattgaggacctgttt
gatcagacgatgcgatggctcgacacgaaacagtcggcggaggctgctgaatttcaagac
aagaagtgggagttgcagattagctttaatccgatacttgccaaggtgaatcagggttaa

DBGET integrated database retrieval system