KEGG   Asparagus officinalis (garden asparagus): CCL56_pgp030Help
Entry
CCL56_pgp030      CDS       T05243                                 

Gene name
rpl22
Definition
(RefSeq) ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
aof  Asparagus officinalis (garden asparagus)
Pathway
aof03010  Ribosome
Brite
KEGG Orthology (KO) [BR:aof00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    CCL56_pgp030 (rpl22)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:aof03011]
    CCL56_pgp030 (rpl22)
Ribosome [BR:aof03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    CCL56_pgp030 (rpl22)
  Bacteria
    CCL56_pgp030 (rpl22)
  Archaea
    CCL56_pgp030 (rpl22)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ribosomal_L22
Motif
Other DBs
NCBI-ProteinID: YP_009370060
AA seq 119 aa AA seqDB search
MKNSNSGKEIKVLAQHICMSVFKARRVIDQIRGRSYEETLMILELMPYRASYPILKLVYS
AAANASHNMGLNEADSFISKAEVNGGPFVKKLRPRARGRSYPIKRPTCHITIVLKDKSK
NT seq 360 nt NT seq  +upstreamnt  +downstreamnt
ataaagaactcaaattcgggtaaagaaataaaagttttagctcaacatatatgtatgtcc
gttttcaaagcgcgaagagtaattgatcagattcgtggtcgttcttatgaggaaacactt
atgatactggaactcatgccttatcgagcatcttatcccattttaaaattggtttattct
gcagcagcaaatgctagtcataatatgggtttgaacgaagctgattcattcattagtaaa
gccgaagtcaatggaggtccttttgtgaaaaagttaagacctagggctagaggacgtagt
tatccgataaaaaggcccacttgtcatataacaattgtattaaaagataaatctaaataa

DBGET integrated database retrieval system