KEGG   Amycolatopsis orientalis: AORI_1222Help
Entry
AORI_1222         CDS       T02678                                 

Definition
(GenBank) inorganic phosphate transporter, PiT family
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
aoi  Amycolatopsis orientalis
Brite
KEGG Orthology (KO) [BR:aoi00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    AORI_1222
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4
Motif
Other DBs
NCBI-ProteinID: AGM03811
UniProt: R4SUI7
Position
1251141..1252271
Genome map
AA seq 376 aa AA seqDB search
MEPSLLVVLVVVTALIFDFTNGFHDTANSMATSIATGALRPKVAVTISAVLNLVGAFLSV
EVAKTISNGLVDDTKIGPAIVFGGLVGAIVWNLITWFIGLPSSSSHALFGGLIGATWVSA
GTDSVHFGKIVEKVLVPAALSPVLAGLVAMAVTYFVYRFFVRRGRTAGFRVGQIISASLV
SLAHGTNDAQKTMGVITLTMITAGTLPAGAGPPLWVIVSAALALALGTYLGGWRITYTLG
KGLTDIDGPQGFAAQTSSAAVILASTNFGFPLSTTHVCSGGIVGSGVGRNESPVRWRTAG
RMVTAWLFTLPAAAIVGAGAGLVTSTGTVGTIAVGVAGLAIGIGIYLLSRRSPVNAGSFT
SPAPPVPEQEVGRIAA
NT seq 1131 nt NT seq  +upstreamnt  +downstreamnt
gtggagccctcactgttggtcgtgctcgtcgtcgtcacggccctaattttcgatttcaca
aacgggttccatgacacggcaaactcgatggcgacgtcgatcgccaccggggcgttgcgg
cccaaggtcgcagtgacgatctccgcggtcctgaacctggtcggagcgttcctgtcggtc
gaggtggccaagaccatctcgaatggactggtcgacgacaccaagatcggcccggcgatc
gtcttcgggggcttggtcggggcgatcgtgtggaacctgatcacctggttcatcggcctg
ccgtccagctcgtcccacgcgctgttcggagggctgatcggtgccacgtgggtgtcggcc
ggaacggactccgtccatttcggaaagatcgtcgagaaggtgctggttccagcggcgctg
tcgccggtcctggccggcctcgtcgcgatggccgtgacgtacttcgtctaccgcttcttc
gtccgccgcggtcgcaccgcgggcttcagagtcggccagatcatctcggcttcgctggtc
tcgctcgcccacggcacgaacgacgcgcagaagaccatgggcgtgatcacgctgacgatg
atcaccgccgggaccctccccgccggggcggggccgccgctctgggtgatcgtcagcgcg
gcgctggcgctggcgctcggcacgtacctgggcggctggcgaatcacctatacgctgggc
aaaggcctcaccgatatcgatggcccgcaggggttcgccgcgcagaccagctcggcggcc
gtcatcctcgcctcgacgaacttcggcttcccgctttcgacgacccacgtctgctcaggc
ggcatcgtcggctccggtgtgggcaggaatgagtcaccggttcgctggcgtacggccggt
cgcatggtgaccgcctggctgttcacgcttccggcagccgccatcgtcggtgcaggtgcc
ggcctcgtgacctcgaccggcacagtgggcacgatcgccgtcggtgtcgcgggcctcgcg
atcggcattgggatctacctcctttcacggcggagccccgtcaatgcaggcagcttcacc
agccccgccccgcccgttccggaacaggaagtcggcaggatcgccgcctag

DBGET integrated database retrieval system