KEGG   Amycolatopsis orientalis: AORI_2631Help
Entry
AORI_2631         CDS       T02678                                 

Gene name
hemY
Definition
(GenBank) protoporphyrinogen oxidase
  KO
K00231  protoporphyrinogen/coproporphyrinogen III oxidase [EC:1.3.3.4 1.3.3.15]
Organism
aoi  Amycolatopsis orientalis
Pathway
aoi00860  Porphyrin and chlorophyll metabolism
aoi01100  Metabolic pathways
aoi01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:aoi00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    AORI_2631 (hemY)
Enzymes [BR:aoi01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     AORI_2631 (hemY)
    1.3.3.15  coproporphyrinogen III oxidase (coproporphyrin-forming)
     AORI_2631 (hemY)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amino_oxidase NAD_binding_8 DAO Thi4 Pyr_redox_2 NAD_binding_9 HI0933_like FAD_binding_2 FMO-like Trp_halogenase Pyr_redox FAD_oxidored
Motif
Other DBs
NCBI-ProteinID: AGM05219
UniProt: R4SNU7
Position
2807546..2808925
Genome map
AA seq 459 aa AA seqDB search
MKTVAVVGGGISGLTAAYRLRTLLGEDARIVVFEATGSLGGKLRTVELAGERYDVGAEAF
LARRPEALALVREVGLGESLVHPTKARAKIHAGGSVLGLPPGTVMGVPASAGAVAGMLSE
KGRALVEAEASLPPLELPAEDVPLGPLLRERFGDELVDRLVDPLLGGVYAGGADGLGLRA
TMPGLASAIDRGATSLTEGAASRLPASPSTAPVFGTLLGGLGTLIARLAELSRAEIRTGT
TVTALDRTPTGWKVDDLDADAVLLAVPAPSARRLLDGVAGVASSVFAKVELASMAVVALA
LPPGTALPESSGVLIGAGERDAAGKPFAAKAFTFSSRKWAQYGEGPVLVRGSVGRFGEPG
ALHADDDELVRVVRDDLARLTGVTAEPIDILVTRWGGGLPQYGTGHLVRVERIERAVAAV
PGLAVAGATLHGVGLPACIATADAAARRIAGITPPHEGS
NT seq 1380 nt NT seq  +upstreamnt  +downstreamnt
gtgaagacggtcgccgtcgtcggtggcgggatctcgggactgaccgcggcgtaccggctg
cggaccctgctcggcgaggacgccaggatcgtcgtcttcgaggcgaccgggtcgctcggc
gggaaactccgcacggtcgaactcgccggtgagcgctacgacgtcggcgcggaggccttc
ctcgcccgccgtcccgaagcgctcgcgctggtgcgtgaggtcgggctgggcgaaagcctc
gtccatcccaccaaggcccgcgcgaagatccacgccggcggttccgtactcggcctgccg
ccgggcacggtcatgggtgttccggcgtcggccggcgcggtcgcggggatgctgtcggag
aagggccgcgcgctggtcgaggccgaggcgtcgctgcctccgctggaactgcccgcggaa
gatgtgccgctcggcccgctgctgcgcgaacggttcggcgacgaactcgtcgaccggctc
gtcgatccgctgctcggcggggtctacgccgggggagcggacgggctcggcctgcgcgcg
accatgcccggcctcgcctccgcgatcgatcgcggcgcgacttcgctcaccgaaggcgcc
gcctcccgcctgcccgcctcgccgagtacggcgccggtcttcggcaccctgctgggcggg
ctcgggacgctgatcgctcggctcgcggagctgtcccgcgccgagatccgcaccgggacc
acggtgacggcgctcgaccgcacccccaccggctggaaggtcgacgacctcgacgccgac
gccgtccttctcgccgtcccggcgccctcggcgcggcggctgctcgacggcgtcgcggga
gtggcctcgtcggtgttcgcgaaggtcgaactcgcgtcgatggcggtggtcgcgctcgcg
ctcccgccggggaccgcgctgccggagtcgtccggggtgctgatcggcgccggggaacgg
gacgccgccgggaagccgttcgccgccaaggcgttcaccttctcgtcccgcaagtgggcg
cagtacggcgaaggtccggtgctggtgcgcggctcggtcggccgcttcggcgaaccgggc
gcgctgcacgccgacgacgacgaactcgtgcgcgtggtccgcgacgatctcgcccggctg
accggggtcaccgccgagccgatcgacatcctcgtgacccgatggggtggcggactcccg
cagtacggcaccgggcacctcgtccgcgtcgagcggatcgaacgtgccgtcgccgccgtt
cccgggctcgccgtggctggcgcgacactgcacggcgtcgggcttccggcctgcatcgcc
accgccgacgccgccgcccgccgcatcgccgggatcacaccgccccacgaaggctcctga

DBGET integrated database retrieval system