KEGG   Amycolatopsis orientalis: AORI_3539Help
Entry
AORI_3539         CDS       T02678                                 

Gene name
dhbE
Definition
(GenBank) 2,3-dihydroxybenzoate-AMP ligase
  KO
K02363  2,3-dihydroxybenzoate-AMP ligase [EC:6.3.2.14 2.7.7.58]
Organism
aoi  Amycolatopsis orientalis
Pathway
aoi01053  Biosynthesis of siderophore group nonribosomal peptides
aoi01110  Biosynthesis of secondary metabolites
aoi01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:aoi00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   01053 Biosynthesis of siderophore group nonribosomal peptides
    AORI_3539 (dhbE)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01008 Polyketide biosynthesis proteins [BR:aoi01008]
    AORI_3539 (dhbE)
Enzymes [BR:aoi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.58  (2,3-dihydroxybenzoyl)adenylate synthase
     AORI_3539 (dhbE)
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.14  enterobactin synthase
     AORI_3539 (dhbE)
Polyketide biosynthesis proteins [BR:aoi01008]
 Nonribosomal peptide synthetase (NRPS)
  Iterative NRPS
   Enterobactin synthetase
    AORI_3539 (dhbE)
   Bacillibactin synthetase
    AORI_3539 (dhbE)
  Nonlinear NRPS
   Vibriobactin synthetase
    AORI_3539 (dhbE)
   Myxochelin synthetase
    AORI_3539 (dhbE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-ProteinID: AGM06124
UniProt: R4SRR8
Position
3874181..3875803
Genome map
AA seq 540 aa AA seqDB search
MTADHVPWPPETAARYRASGYWRGQTFGKLLTSLAEAYAERLAVIGENARWTFAELDERA
HRLAAGFAGAGIQAGDRVVVQLPNVPEFASVVFGLWRAGALPVFALPAHRASELRHFAEQ
SEAAAILTVGEHERFDHAAMARAVAAEIPSVRNVFVVGTEEFAVLEAATPRALPDPDPAG
VAFLQLSGGSTGLPKLIPRTHDDYLYSVRESSRICGLRPESVYLAALPVAHNFPLSSPGL
LGALHAGAATVFAPRPDADTAFRLIEAEGVTITGLVPPLAAAWAQAAARTGRDLSSLDVL
LVGGAKCARELAEKIGPALGCRLQQVFGMAEGLVCYTRLDDPDEYVLATQGRPISPDDEI
RVVNPDDPLSTSDDVVAPGEVGALLTRGPYTIRGYYRAEEHNKTAFTEDGFYRTGDLVRR
HPSGHLEVVGRAKEQINRGGEKVAAEEVENHLMAHPGVLDAAVVAVPDPYLGERTCAYVV
PAAGAEPAAAELRRFVRERGVAAFKVPDLVQVVPEFPVTGVGKTSKRELRAALAALAKEK
NT seq 1623 nt NT seq  +upstreamnt  +downstreamnt
atgaccgccgatcacgtgccgtggccaccggaaaccgcggcgcgctaccgggcttcgggg
tactggcgcggccagaccttcgggaagctgctgaccagtctcgccgaggcgtacgccgag
cgcctcgccgtgatcggcgagaacgcccgctggacgttcgccgaactcgacgagcgcgcg
caccggctcgccgccggattcgccggggccgggatccaggccggtgaccgggtcgtcgtg
caactgccgaacgtgccggagttcgcgtccgtcgtgttcggactgtggcgggccggtgcg
ctgccggtgttcgcgctgcccgcgcaccgcgcgagcgaactgcggcatttcgccgagcag
agcgaggccgcggcgatcctcaccgtcggcgaacacgaacggttcgaccacgcggccatg
gcgcgcgcggtcgcggccgagatcccctcggtgcgcaacgtcttcgtcgtcggcacggag
gaattcgccgtcctggaagcggcgactccgcgcgctctgccggatcccgatcccgccggg
gtcgcgttcctccagctgtccgggggaagcaccggattacccaagctgatcccgcgcacg
cacgacgactatctctacagcgtccgggaaagctcccggatctgcggcctgcgcccggaa
agcgtgtacctggccgcgttgccggtcgcgcacaacttcccgctcagctcgcccggcctg
ctcggcgcgctgcacgcgggcgcggcgacggtgttcgcgccgcggcccgacgccgacacc
gcgttccggctcatcgaggccgaaggcgtgacgatcaccgggctcgtaccgccgctcgcc
gcggcgtgggcgcaggcggccgcgcggaccgggcgcgatctgtcctctttggacgtcctg
ctggtcggcggcgcgaaatgcgcccgtgaactggccgagaagatcgggcccgcgctggga
tgccgtctgcagcaggtgttcggcatggccgaagggctggtctgctacacccggctcgac
gacccggacgagtacgtcctcgccacacagggacggccgatttcgccggacgacgagatc
cgcgtggtgaacccggacgatccactgtccacttcggacgacgtcgtcgcgccgggggag
gtcggcgcgctgctgacccgcggcccgtacacgatccgcggctattaccgcgccgaggag
cacaacaagaccgcgttcaccgaggacggtttctaccgcaccggtgacctcgtgcggcgg
catccgtccgggcatctggaagtggtcggccgggccaaggaacagatcaaccgcggtggc
gagaaggtggccgctgaggaggtcgagaaccacctgatggcccaccccggcgtgctcgac
gccgccgtcgtcgcggtgccggacccgtacctgggcgagcgcacctgcgcctacgtcgtc
ccggccgccggtgccgaacccgcggcggcggagctgcgccggttcgtccgggaacgcggg
gtcgcggcgttcaaggtgcccgatctggtccaggtggtgccggagttcccggtgaccggg
gtcggcaagaccagcaaacgcgagctgcgggcggcgctggccgctctggcgaaggagaag
tga

DBGET integrated database retrieval system