KEGG   Amycolatopsis orientalis: AORI_5780Help
Entry
AORI_5780         CDS       T02678                                 

Definition
(GenBank) alpha/beta hydrolase fold-3 domain-containing protein
  KO
K14731  epsilon-lactone hydrolase [EC:3.1.1.83]
Organism
aoi  Amycolatopsis orientalis
Pathway
aoi00903  Limonene and pinene degradation
aoi00930  Caprolactam degradation
aoi01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:aoi00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    AORI_5780
  09111 Xenobiotics biodegradation and metabolism
   00930 Caprolactam degradation
    AORI_5780
Enzymes [BR:aoi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.83  monoterpene epsilon-lactone hydrolase
     AORI_5780
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Abhydrolase_3 Say1_Mug180 Abhydrolase_6 Hydrolase_4 DLH
Motif
Other DBs
NCBI-ProteinID: AGM08363
UniProt: R4TD76
Position
6539077..6539724
Genome map
AA seq 215 aa AA seqDB search
MTSTIVYAHGGGFTSYDPEIGRLRTDALQAAGLRVVPVEYRLAPAHRHPAQVDDVLDVYR
SVKGPVVFLGESAGGTIVLSALLRLLAEGEPLPAGAAAISPVADLTLPGGSFVTNDGADI
ITRDALRRSVEAYLGEGVAGPASPSHGDFAGSPPLWLAVGTAEVLLDDVVTLATSARESG
VTTELRVYEGAQHGFQFLGGYTVDKELAGWIEALG
NT seq 648 nt NT seq  +upstreamnt  +downstreamnt
atgacgtccacgatcgtctacgcccacgggggcggcttcacctcgtacgacccggaaatc
gggcggctgcggaccgacgccttgcaggccgccgggctccgggtcgtgccggtggagtac
cggctggccccggcgcaccgtcacccggcgcaggtcgacgacgtcctcgacgtctaccgg
tccgtcaagggtcctgtcgtgttcctgggcgagtccgcgggcgggacgatcgtgctctcg
gcgctcttgcggctcctcgccgagggcgaacccctcccggccggggccgccgcgatctcc
ccggtcgcggatttgacccttccgggcggttcgttcgtcaccaacgacggcgccgacatc
atcacccgcgacgcgctccgccgatcggtggaggcgtacctcggcgagggcgtggccgga
cccgcgtcgccgtcgcacggcgacttcgccgggtcaccgccgctgtggctcgcggtgggt
accgccgaagtcctgctcgacgacgttgtgacactggccacctcggcaagggaatccggt
gtcaccacggaactccgcgtctacgaaggtgcccagcacggcttccaattcctgggcgga
tacaccgtcgacaaggagctcgcaggatggatcgaggcgctcggctga

DBGET integrated database retrieval system