KEGG   Bradyrhizobium oligotrophicum: S58_06850Help
Entry
S58_06850         CDS       T02484                                 

Gene name
apaG
Definition
(GenBank) ApaG protein
  KO
K06195  ApaG protein
Organism
aol  Bradyrhizobium oligotrophicum
Brite
KEGG Orthology (KO) [BR:aol00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    S58_06850 (apaG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525 DUF4962
Motif
Other DBs
NCBI-ProteinID: BAM86699
UniProt: M4Z1A9
Position
complement(759004..759396)
Genome map
AA seq 130 aa AA seqDB search
MYRAVTRHIEVTVEPNFLPEKSSVADGRWFWSYTVVITNTGEETVRLRSRHWIITDGVGR
QQEVRGEGVVGEQPVLAPGERFEYTSGVPLTTASGFMSGSYQMESDSGEQFDIAVPAFSL
DSPEGKRVLN
NT seq 393 nt NT seq  +upstreamnt  +downstreamnt
atgtaccgcgccgtgactcgccacatcgaagtgaccgtcgaaccgaacttcctgcccgag
aaatcgtcggtcgcggatggccgctggttctggtcgtataccgtcgtcatcaccaacacc
ggcgaggagaccgtgcggctgcgcagccggcattggatcatcaccgacggcgtcggccgg
cagcaggaggtccgcggcgaaggcgtggtcggcgagcagccggtgctcgcccccggcgag
cgcttcgaatacacctccggcgtcccgctcaccaccgcctccggcttcatgtccggctcc
taccagatggagagcgacagcggcgagcagttcgacattgcggtgcccgcgttctcgctg
gacagccccgagggcaagcgggtgttgaactag

DBGET integrated database retrieval system