KEGG   Bradyrhizobium oligotrophicum: S58_18620Help
Entry
S58_18620         CDS       T02484                                 

Definition
(GenBank) non-hemolytic phospholipase C
  KO
K01114  phospholipase C [EC:3.1.4.3]
Organism
aol  Bradyrhizobium oligotrophicum
Pathway
aol00562  Inositol phosphate metabolism
aol00564  Glycerophospholipid metabolism
aol01100  Metabolic pathways
aol01110  Biosynthesis of secondary metabolites
aol02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:aol00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    S58_18620
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    S58_18620
   00565 Ether lipid metabolism
    S58_18620
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    S58_18620
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02042 Bacterial toxins [BR:aol02042]
    S58_18620
Enzymes [BR:aol01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.3  phospholipase C
     S58_18620
Bacterial toxins [BR:aol02042]
 Type II toxins: Membrane damaging toxins
  Toxins that enzymatically damage the membrane
   S58_18620
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Phosphoesterase DUF756 TAT_signal LPD24
Motif
Other DBs
NCBI-ProteinID: BAM87869
UniProt: M4Z408
Position
2142412..2144550
Genome map
AA seq 712 aa AA seqDB search
MNDMSNTIAHNRREFLRLLGASAATAALGQSIERAHAIPAFNRHGSIKDVEHIVVLMQEN
RAFDHYFGAMRGVRGFNDPRAVKLPNGNPVWQQPNGAGSVMPFRVDNAGSVYVEDVAHGW
NDGQKSWNNGNYDKWIANKGTTTMTCMNRQDLPWHYALADAFTVCDSYFCSVMGPTDPNR
YYLWTGWDGNDGKNGGPVITNAEAGYDWTTFPERLEKAGISWKVYQDVGVGLTAAGFWGW
TENPWIGNYGDNSLLYFHQYQNSQPGSPLYEKALRGSNIANGGTFENLFDGLRNDVRNGT
LPQVSWIAAPEAFSEHPNWLPGPGAWYISKVLDILTSNPELWSKTALLINYDEGGGFFDH
VVGPYPAMSQAWGQSTVDVTSDLFAGDGSHLAGPYGLGVRVPMLVVSPWSRGGFVCSEVF
DHTSVIRFIERRFHHKAPDLFESNIPAWRRAVCGDLTSAFNFTSPNEGMAPLPSTAGFKP
PVADITSGARFDDYHPVPPAKQVLPQQEPGLRPARPLPYDLRVDGDADAAQKTFAIRFAN
PGQAGVCFHVRSGNTATGPWSYTVEAGKSLRGVWDLAASAGQYDLSVHGPNGFFRHFKGG
VATTAALVDVDTVHLCDWDDGDDTRSLAVALTNKGASCVVTLADNYTGRSERHRLQRGQR
LETQIRLQQTHGWYDLTVTADTDAGFSWQLAGHVENGRPSISDPAMGKIAAT
NT seq 2139 nt NT seq  +upstreamnt  +downstreamnt
atgaacgatatgtcgaacacgatcgcgcacaaccggcgcgagttcctgcggctgctcgga
gcctcggctgcgaccgcggccctcggccagagcatcgagcgggcccacgccattccggcg
ttcaaccgccacggcagcatcaaggacgtcgagcacatcgtggtgctgatgcaggagaat
cgcgccttcgatcattatttcggcgcgatgcgtggggttcggggcttcaacgatccgcgc
gccgtgaagctgccgaacggcaacccggtatggcagcagccgaacggcgccggttcggtg
atgccgttccgcgtcgacaatgccggctcggtctatgtcgaggacgttgcccatggctgg
aatgacggccagaagtcctggaataacggcaactacgacaagtggatcgccaacaagggc
accacgaccatgacctgcatgaaccggcaggatctgccctggcactatgcgctggccgac
gccttcacggtgtgcgattcctatttctgctcggtgatggggccgaccgatccgaatcgg
tattatttgtggaccggctgggacggcaatgacggcaagaatggcggcccggtcatcacc
aatgccgaggccggctacgactggaccacgttcccggagcggctggagaaggccggcatc
tcctggaaggtctatcaggatgtcggcgtcggcctgacggcggccggcttctggggctgg
acggaaaatccgtggatcggaaactacggcgacaactcgctgttgtacttccatcaatac
cagaactcgcaacccggcagcccgctctatgagaaggcgctgcgcggcagcaacatcgcc
aatggcggcacgttcgagaacctgttcgacgggctccgcaacgacgtgcgcaacggcacc
ctgccacaggtgtcgtggatcgcggcgcccgaggcgttcagcgagcatccgaactggctg
ccggggccgggcgcctggtatatctccaaggtgctcgacatcctgacgtcgaatccggag
ctgtggagcaagaccgcgctgctcatcaactacgacgagggcggcggcttcttcgaccat
gtcgtcggtccgtatccggcgatgtcgcaagcctggggacaatcgacggtcgacgtcacc
agcgatctgttcgccggcgatggcagccacctggccggcccgtacggtctcggcgtccgc
gtgccgatgctggtggtatcgccgtggtcgcgcggcggcttcgtgtgctcggaggtgttc
gaccatacctcggtgatccgcttcatcgagcgacgttttcatcacaaggcgcccgatctg
ttcgagagcaacatcccggcgtggcggcgcgcggtgtgcggcgatctcacctcggcattc
aacttcacctcgcccaacgaaggcatggcgccgctgccgagcacggccggcttcaagccg
ccggtcgcggacatcacctccggtgcgcgcttcgacgactaccacccggtgccgccggcc
aagcaggtgctgccgcagcaggagccgggcctgcgtcccgcgcgtccgctgccctacgat
ctccgcgtcgacggcgatgccgacgccgcgcagaagacgttcgcgatccgcttcgccaat
ccgggccaggcgggcgtctgcttccacgtccgctccggcaacaccgcgaccggtccgtgg
agctacacggtcgaggccggcaagtcgctgcgcggcgtgtgggacctcgccgccagcgcc
gggcagtacgatctgtcggtgcatggtccgaatggcttcttccgccacttcaagggcggc
gtcgccaccacggccgcgctggtcgatgtcgatacggttcatctctgcgattgggacgac
ggtgacgacacgcgcagcctcgcggttgcgctgaccaacaagggcgccagctgcgtggtg
acgctcgccgacaactacaccgggcgcagcgagcggcatcgcctgcagcgtggccagcgg
ctggagacgcagattcgtctgcagcagacccatggctggtacgatctgacggtgacggcg
gacaccgatgccggcttcagctggcagctcgcgggtcatgtcgagaacggccggcccagc
atcagcgacccggcgatgggcaagatcgccgcgacctga

DBGET integrated database retrieval system