KEGG   Bradyrhizobium oligotrophicum: S58_24210Help
Entry
S58_24210         CDS       T02484                                 

Definition
(GenBank) serine-glyoxylate aminotransferase
  KO
K00830  alanine-glyoxylate transaminase / serine-glyoxylate transaminase / serine-pyruvate transaminase [EC:2.6.1.44 2.6.1.45 2.6.1.51]
Organism
aol  Bradyrhizobium oligotrophicum
Pathway
aol00250  Alanine, aspartate and glutamate metabolism
aol00260  Glycine, serine and threonine metabolism
aol00630  Glyoxylate and dicarboxylate metabolism
aol00680  Methane metabolism
aol01100  Metabolic pathways
aol01110  Biosynthesis of secondary metabolites
aol01120  Microbial metabolism in diverse environments
aol01130  Biosynthesis of antibiotics
aol01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:aol00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    S58_24210
  09102 Energy metabolism
   00680 Methane metabolism
    S58_24210
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    S58_24210
   00260 Glycine, serine and threonine metabolism
    S58_24210
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:aol01007]
    S58_24210
Enzymes [BR:aol01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.44  alanine---glyoxylate transaminase
     S58_24210
    2.6.1.45  serine---glyoxylate transaminase
     S58_24210
    2.6.1.51  serine---pyruvate transaminase
     S58_24210
Amino acid related enzymes [BR:aol01007]
 Aminotransferase (transaminase)
  Class V
   S58_24210
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_5
Motif
Other DBs
NCBI-ProteinID: BAM88427
UniProt: M4Z5P6
Position
2730149..2731342
Genome map
AA seq 397 aa AA seqDB search
MTVHTGRHFLQIPGPTNVPDRVLRAMDMPTLDHRGPEFAELGFAVLAASQRIFRTKQPVI
IYPSSGTGAWEAAIVNTLAPGDKVLMAETGQFAVLWRGIADKFKLDVDFIPGDWRHGADI
AAIEQRLVDDKAHKIKAVCVVHNETSTGCLTPPLEVRKALDRAGHPALLMVDTISGLGSM
EYEHDAWGVDVSVAGSQKGLMLPPGLGFNAVSEKALAVAKANPGMRSYWDWQEIITFNKL
GTFPYTPACNLLMGLNEALKMLEEEGHENVFARHRRHSRATRAAVKAWGLDTQCADAQAH
SPALTGVVLPEGHDADQFRKTVLENFDMSLGTGLNKIKGKVFRIGHIGHFNDLMLMGTLA
GVEMGLALANVPHRAGGVLAAMDVLKAREAAPITKVA
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgactgtgcacacaggacggcattttcttcagattccggggccgaccaatgtgcccgac
cgcgtcttgcgcgcgatggacatgccgacgctggaccatcgcggtcctgagttcgccgaa
ctcggcttcgccgtgctggccgccagccagcgcatcttccgcaccaagcagccggtgatc
atctatccgtcgtccggcaccggcgcgtgggaagctgcgatcgtcaacacgctcgcgccc
ggcgacaaggtgctgatggctgagaccggccagttcgcggtgctgtggcgaggcattgcc
gacaagttcaagctcgacgtcgacttcatccccggcgactggcgccatggtgccgacatc
gcggcgatcgagcagcggctcgtggacgacaaggcgcacaagatcaaggccgtctgcgtc
gtgcacaacgagacctcgaccggctgcctgacgccgccgctggaggtgcgcaaggcgctc
gatcgcgccggccatccggcgctgctgatggtcgacaccatctccggcctcggctcgatg
gaatatgagcatgacgcctggggcgtcgacgtctccgtcgccggctcgcagaagggcctg
atgctgccgccgggtctcggcttcaacgccgtttcggagaaggcgctcgccgtcgccaag
gccaatcccggcatgcgctcgtattgggactggcaggagatcatcaccttcaacaagctc
ggcaccttcccgtatacgccagcctgcaatctgctgatgggcctcaacgaagcgctgaag
atgctggaggaggaggggcacgagaacgtgttcgcgcgccatcggcgccacagccgggcc
acgcgcgccgcagtcaaggcctgggggctcgacacgcaatgtgccgatgcgcaggcgcat
tcgccggcgctcaccggcgtcgtcctgcccgaggggcatgatgccgatcagttccgcaag
acagtgctggaaaacttcgacatgtcgctcggcaccggcctcaacaagatcaagggcaag
gtgtttcgcatcggccatatcggtcacttcaatgacctgatgctgatggggacgctcgcc
ggcgtcgagatgggccttgcgctcgccaatgtgccgcatcgcgcgggtggcgtgcttgca
gcgatggatgtcctcaaggcgcgtgaggctgcgccgattacgaaggtggcctga

DBGET integrated database retrieval system