KEGG   Bradyrhizobium oligotrophicum: S58_24880Help
Entry
S58_24880         CDS       T02484                                 

Definition
(GenBank) ADP-glyceromanno-heptose 6-epimerase
  KO
K03274  ADP-L-glycero-D-manno-heptose 6-epimerase [EC:5.1.3.20]
Organism
aol  Bradyrhizobium oligotrophicum
Pathway
aol00540  Lipopolysaccharide biosynthesis
aol01100  Metabolic pathways
Module
aol_M00064  ADP-L-glycero-D-manno-heptose biosynthesis
Brite
KEGG Orthology (KO) [BR:aol00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00540 Lipopolysaccharide biosynthesis
    S58_24880
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01005 Lipopolysaccharide biosynthesis proteins [BR:aol01005]
    S58_24880
Enzymes [BR:aol01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.20  ADP-glyceromanno-heptose 6-epimerase
     S58_24880
Lipopolysaccharide biosynthesis proteins [BR:aol01005]
 Unusual sugar
  S58_24880
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Epimerase GDP_Man_Dehyd 3Beta_HSD RmlD_sub_bind Polysacc_synt_2 NAD_binding_4 KR
Motif
Other DBs
NCBI-ProteinID: BAM88494
UniProt: M4Z5D9
Position
2802216..2803196
Genome map
AA seq 326 aa AA seqDB search
MLLVTGGAGFIGSNLVAALNDAGRTDVIVCDELGSEGKWRNLAKRQLADVVPPSDLGEWL
KGRRLDAVLHMGAISATTVVDGDLVMERNFRSSLRLLDWCTASATPFIYASSAATYGDGA
QGFVDEPSLAALKTLRPMNLYGWSKHLFDMAIAARVERGEQLPPQYAGLKFFNVFGPNEY
HKGSMMSVLTRRFDDIKAGHTLQLFKSHRDGIADGDQRRDFIYVDDVVRVMMWLLASPPV
SGLFNVGTGQARSFKDMMLAAYATLGATPRIEYIDMPEAIRGSYQYFTQSKVDRLLAAGY
NGGFTALEDAVAHYIGGYLDSADRFR
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atgttgctggtgaccggcggcgccgggtttatcggatcgaacctagtggcagcgctcaat
gatgccggccgtactgacgtgatcgtctgtgacgaactcggcagcgagggcaaatggcgg
aaccttgccaagcgtcagctcgccgacgtcgtacccccatccgatctgggcgagtggctg
aagggccgcaggctcgatgccgtcctgcacatgggcgccatctccgccaccacggtcgtc
gacggtgacctagtcatggaacgcaatttccgcagctcgctgcggctgctcgactggtgc
acggcgagcgccacgccgttcatctatgcctcctctgcagcgacctatggcgacggcgcg
cagggcttcgtcgacgagccgtcgttggccgcgctcaagacgctgcggccgatgaatctg
tacggctggagcaagcatctgttcgacatggcgatcgccgcgcgcgtcgaacggggcgag
cagctgccgccgcaatatgccgggctcaagttcttcaacgtgttcggtcccaacgagtac
cacaagggatcgatgatgagcgtgctgacccgccgcttcgacgacatcaaggccgggcac
actctgcagctgttcaagtcgcatcgggacggcatcgccgacggcgaccagcgccgtgat
ttcatctatgtcgacgacgtcgtgcgggtgatgatgtggctgctggcctcgccccccgtc
tccggtctcttcaacgtcggcacgggccaggcccgcagcttcaaggacatgatgctggcg
gcctatgcgacgctcggcgcgacgccccggatcgagtacatcgacatgcccgaggcgatt
cgcggcagctatcagtatttcacccagagcaaggtcgaccggctgctggccgccggctac
aacggcggcttcacggccctcgaggacgcggtcgcccactatatcggcggctatctcgat
tccgccgaccgcttccgctag

DBGET integrated database retrieval system