KEGG   Bradyrhizobium oligotrophicum: S58_28810Help
Entry
S58_28810         CDS       T02484                                 

Definition
(GenBank) L-fuculose phosphate aldolase
  KO
K01628  L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
aol  Bradyrhizobium oligotrophicum
Pathway
aol00051  Fructose and mannose metabolism
aol01100  Metabolic pathways
aol01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:aol00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    S58_28810
Enzymes [BR:aol01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     S58_28810
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldolase_II
Motif
Other DBs
NCBI-ProteinID: BAM88882
UniProt: M4Z6Q6
Position
3245580..3246338
Genome map
AA seq 252 aa AA seqDB search
MNREERLLRENIIAKCRWMNASGLNQGTSGNISARYKDRMLITPSATPYDLMKPDMIASM
PLEGDYGSWDGPLKPSTEWRFHLDIMRGRADVGGVVHTHSTYATVLAIARKSIPACHYMM
AAFGGNDVRCAGYARYGTAELSELALAALEGRNGCLLANHGMIAVGANLDKAMWLAVELE
TIAKQYYLSLALGQPHILGDAEIAETAQGFSTYGLQEPKAKATKSAKPVKAATKTRAAAE
RRKPEKKRSIKR
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atgaatcgcgaggaacgactgctccgcgaaaacatcatcgccaaatgccggtggatgaac
gcgtcgggcctgaaccagggcacctcgggcaacatctccgcccgctacaaggatcgcatg
ctgatcacgccgtcggccacgccctatgacttgatgaagccggacatgatcgcctcgatg
ccgctcgagggcgactacggatcctgggacgggccgctgaagccctcgacggaatggcgc
tttcatctcgacatcatgcgcgggcgcgccgatgtcggtggtgtcgtgcacacccactcg
acctacgccaccgtgcttgcgatcgcgcgcaagtcgatcccggcctgccactacatgatg
gcagcgttcggcggcaatgacgtccgctgcgccggctatgcgcgctacggcacagcggag
ctgtcggagctcgcgctcgccgcgctcgagggtcgcaacggctgcctgctcgccaatcat
ggcatgatcgcggtgggtgccaatctcgacaaggcgatgtggctcgcggtcgagctcgag
accattgcgaagcagtactatctgtcgctcgcgctcggccagccgcacatcctcggtgac
gccgagatcgccgagacggcgcagggcttttcgacttacgggctgcaggagcccaaagcg
aaggcgaccaagtcggccaagcctgtcaaggcggcaacgaagacgcgtgccgccgccgag
cgtcgcaagcctgagaagaagcgcagcatcaagcgatga

DBGET integrated database retrieval system